KEGG   Citrobacter rodentium: ROD_42931Help
Entry
ROD_42931         CDS       T01145                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cro  Citrobacter rodentium
Brite
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ROD_42931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4539176..4540570
Genome map
AA seq 464 aa AA seqDB search
MKIITRLTAIAIAGIVICYSGLSAYVWYHDKQRSQSASVQPSGLEENNQVLGFLREKGCD
YCHTPSAELPFYSSFPVAKQLMDYDIQLGYKSFNLEAVRAALVANEPVSQSDLNKIEWVM
QYETMPPMRYTALHWAGKVSDAERETILGWIAKQREQYYASSDTAAQHRNEPVQPIPEVL
PTDAQKVALGFTLYHDPRLSGDSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNIEQFWDGRAPTLQAQAGGPPLNPIEMASKPWDEIITKLDKDPLLKQQFLAVYPQG
FSGETITDAIAEFEKTLITPDSPFDKWLRGDENALTARQKHGYQLFKDNKCATCHGGVIL
GGRSFEPLGLKRDFNFGEMTAADIGRMNVTNEMRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKEIPQEEIDDIVAFLESLTGVYTPYMQGK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcattactcgtcttaccgcgatcgctatcgcaggcattgttatttgttattca
ggattatctgcttacgtctggtatcacgataaacaacgtagtcagagcgcatccgttcag
ccctccgggctggaagaaaataatcaggtgctgggttttctgcgcgagaaaggatgcgat
tattgtcatactccttccgccgaattacctttttattcctcttttcccgtcgctaagcaa
ctgatggattacgatatccagcttggctataaatctttcaatctggaagccgttcgtgcc
gcgttagtggcgaacgaaccggtatcacagagcgatctgaacaagattgaatgggtgatg
cagtacgaaaccatgccgccaatgcgctataccgcgctgcactgggccggtaaggtgagt
gatgcagagcgggaaaccatcctggggtggattgcgaagcagcgcgaacagtattacgcc
agtagcgacaccgccgcgcagcaccgtaatgaaccggtgcagccgattccagaagttttg
ccgaccgatgcgcaaaaagtggcgctgggattcacgctgtatcacgatccgcgcttgtcc
ggcgacagcaccatctcctgcgctcactgccatgcgctgaatgcgggcggcgtggatggt
cgtaaaacgtcgatcggcgtgggcggcgcggtgggtccaatcaatgcgccgacggtattc
aactctgtctttaatattgagcagttctgggacggacgtgcgccaaccctgcaggcgcag
gcgggcgggccgccgctgaacccgatcgaaatggcgtccaaaccctgggacgaaatcatc
acgaaactcgataaagatccattgctgaaacagcagttccttgccgtttatccgcaggga
ttcagcggggagacgatcaccgacgcgattgctgagtttgagaaaacgctgattacgccg
gattcgccgtttgataaatggctgcgcggtgatgagaacgcgctgacggcccggcagaag
cacggctatcaactgttcaaggataataagtgcgccacctgtcacggcggcgtgattctc
ggcggacggtcgtttgagccgttgggtttaaagcgggactttaactttggtgaaatgacc
gcggcggatattggccgcatgaacgtcactaacgagatgcgggataaattacgccagaag
gtgccggggctgcgcaatgtcgcgttgaccgcgccctatttccaccgcggcgatgtgcca
acgctggacggcgcggtaaaactgatgctgcgttaccaggtgggtaaagagattccccag
gaagagattgacgatattgtcgcttttctcgaaagcctgaccggggtgtatacgccttat
atgcagggcaagtaa

DBGET integrated database retrieval system