KEGG   Citrobacter rodentium: ROD_44071Help
Entry
ROD_44071         CDS       T01145                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cro  Citrobacter rodentium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROD_44071 (malQ)
Enzymes [BR:cro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ROD_44071 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4658816..4660903
Genome map
AA seq 695 aa AA seqDB search
MDSKRLDNAALAAGISPNYINAHGKPQSISAETRRRLLDAMHRTPAATKGTASPVPGVKV
YTAGKKMPLTVEGKGEFHWLLTTEQGEQFKGRASGGKAFNLPAKLPLGYHTLTLTQGELR
SHCRIVVAPKRCYEPQALLDGQKLWGACVQLYTLCSANNWGVGDFGDLKSMLVDIGRRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWRMPTTQQ
TLKQAREADWVDYSTVTALKMAALRMAWKRFAVRDDEQMAAFRYFVTQEGESLYWQAAFD
AIHAHQVQEDELRWGWPVWPEAYRSVDSPAVKTFCEEYRDEVDFYLWLQWLAYTQFAACW
ETSQGFKMPVGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIMAARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLL
SILALESQRHQCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFENDHEKNYRAPQAYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEEVLRGLYQDRELAKQGLLDALHTYGC
LPKRAGRKASLMSMTPVLNRAMQRYIADSHSALLGLQPEDWLDMAEPVNIPGTSYQYKNW
RRKLSASLEAMFADERVNKLIKDLDKRRRAVGKKR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggatagcaaacgtctggataatgccgcgctggcggcggggatcagccccaactatatc
aatgcccacggtaaaccgcagtccattagcgccgaaaccaggcggcgtttgctggacgcg
atgcaccgtacccccgccgccacgaaggggacggcatccccggtgccgggcgttaaggtg
tataccgcaggtaaaaagatgccgcttaccgttgaagggaagggcgaatttcactggctg
ctgacgaccgagcagggcgaacagttcaaaggccgtgcgtccggcggcaaagcgtttaac
ctgccggcgaagctgccgctcggttatcacaccctgacgctgacccagggagaactgcgc
agccattgccggatcgtcgtcgcgccgaagcgctgctatgagccgcaggcgctgctggac
gggcaaaaactgtggggcgcgtgcgtgcagctctataccctatgttccgcaaacaactgg
ggagtcggcgattttggcgatctgaaatcgatgctggtggatatcggcagacgcggcggg
gcgtttatcggcttaaatccgattcacgccctctatccggccaatccggaaagtgccagc
ccctatagtccctcatcacgccgctggctgaacgtgatttatattgacgtcaatgcggtt
gaagatttccagcgcagcgaagaggcgcaggcgtggtggcgaatgccaaccacgcagcag
acgctgaagcaggcgcgtgaggccgactgggttgattactccacggttaccgcgctgaaa
atggcggcgctgcgtatggcgtggaaacgctttgccgtgcgtgacgatgagcagatggcg
gcatttcgctatttcgtgacgcaggagggtgaaagcctctactggcaggcggcgtttgac
gcgattcatgcgcatcaggtgcaggaagacgaactacgctggggctggccggtgtggccg
gaagcgtaccggtcggtagactccccggcggtgaaaactttctgcgaggaatatcgcgac
gaggtggatttctatctctggctgcaatggctggcgtacactcagttcgccgcctgttgg
gaaaccagccagggctttaagatgccggtcggcctgtaccgcgatctggcggtgggcgtc
gcggaaggcggcgcggagacttggtgtgaccgcgagctgtactgcctgaaagcctccgtc
ggcgcgccgccggatattctcggtccgctcgggcagaactggggcctgccgccaatggac
ccgcatatcatggcggcgcgcgcctacgagccgtttatcgaactgctgcgcgccaatatg
cagaactgcggcgcgctgcgcatcgaccacgtgatgtcgatgctgcgtctgtggtggatc
ccgtatggtgaaaccgccgaccagggggcgtatgttcactatccggtcgacgatctgctg
tcgattctggcgctggaaagccagcgtcatcagtgcatggtgattggcgaagatctgggc
actgtgccggtggagattgtcagcaagctgcgcaacagcggcgtttactcatacaaggtt
ctctatttcgagaacgatcatgagaaaaactaccgcgcgccgcaggcgtatccggaacag
tcaatggccgtcgcgaccacgcatgatcttcctacgctgcgcggctattgggagagcggc
gatctgacgctgggcaaaacgctggggctgtaccctgatgaagaggtgctgcgcggactg
tatcaggaccgcgaactggcgaagcaggggctactggatgcgctgcatacatatggctgt
ctgccgaaacgcgccgggcgcaaggcttcgctgatgtcgatgacgccggtgctcaatcgc
gctatgcagcgttatatcgccgacagccatagcgcgctgctggggctgcagccggaggac
tggctggatatggcggagccggtgaacattccgggcaccagctatcagtataaaaactgg
cgtcgtaagctttccgcttctcttgaggcgatgtttgccgatgagcgggtgaacaagctg
attaaggatctcgataagcgcaggcgggcagtgggtaaaaagcgataa

DBGET integrated database retrieval system