KEGG   Citrobacter rodentium: ROD_47111Help
Entry
ROD_47111         CDS       T01145                                 

Gene name
lys
Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cro  Citrobacter rodentium
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4958003..4958503
Genome map
AA seq 166 aa AA seqDB search
MPKLPAPLRKKLIALVLAGAGTFTIATHYTGYWEGKENTTYIDPTGTPTICHGHTGPDVK
PGMTKTDEECLALLEKDMKWAFAAIDRYVQVPLTRGQTVALASWIFWAGETNFRNSTLLR
LINAGQMPASCKQYIRWIYSKGVKLPGLEARRSADEWLCRYDLPKV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaactccccgcgccactgcgtaaaaagctgattgcccttgttctggccggagcc
gggacgttcaccattgccacgcactacaccggctactgggaagggaaagaaaacaccacg
tacattgatcccaccggcacccccaccatctgccacggccataccggcccggatgtgaaa
ccggggatgacaaaaactgatgaagaatgtctggcgctgctggaaaaggacatgaaatgg
gcctttgcggccattgatcgttatgttcaggtgccgcttacccgtggtcagacggtggcg
ctggcctcctggattttctgggccggtgaaacgaactttcgcaactccacgctcctgcgc
cttatcaatgccgggcagatgcccgcgtcctgtaagcagtacatccgctggatttattca
aagggagtaaaactccccggtcttgaggcccgccgttcggcggatgaatggttatgtcgc
tacgatttgccgaaagtctga

DBGET integrated database retrieval system