KEGG   Citrobacter rodentium: ROD_49051Help
Entry
ROD_49051         CDS       T01145                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:4.1.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cro  Citrobacter rodentium
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ROD_49051 (deoA)
Enzymes [BR:cro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ROD_49051 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5167491..5168813
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTVSEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLQLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFRDIIKEVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGQLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDLVENYAKYLPSAMLSKAVYADTEGFVSAMDTRALG
MAVVSMGGGRRQASDSIDYSVGFTDMVRLGDGVDGQRPLAVIHAKDEACWQDAAQAVKAA
ITLDDKAPEITPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctgagtgatgaa
gagatccgcttctttatcaacggcattcgtgacaataccgtttcggaaggtcagattgcc
gccctggcgatgaccatcttcttccacgatatgaccatgccggagcgcgtatcgctgacg
atggcaatgcgggattcaggcaccgtcctggactggaagagtctgcaactgaacggccca
atcgttgataaacactccaccggcggggtgggcgatgtaacatcgctgatgctggggccg
atggtcgcggcctgcggcggctatgtgccgatgatctccggtcgcggcctcggtcatacc
ggcggtacgctcgacaaactggaagccattccgggcttcgatatcttcccggacgacaac
cgtttccgcgacattattaaagaggtgggcgtagcgattatcgggcagaccagttcgctc
gccccggcggacaaacgtttttatgccacccgcgatattaccgcgacggtggactccata
ccgctgattaccgcttccatactggcgaaaaagctggccgaagggctggatgcgctggtg
atggacgtgaaagttggcagcggcgcgtttatgccgacgtatgaactttctgcagcgctt
gccgaagcgattgtcggcgtggcgaacggcgcgggtgtccgtacgaccgcgctgcttacc
gacatgaatcaggtgctggcctccagtgccggtaacgcggtggaagtgcgcgaggcggtg
cagttcctgaccggcgaatatcgtaacccgcgcctgtttgacgtcacgatggcgctgtgc
gttgagatgctcatctccggccagctggcgaaagacgatgccgaagcgcgcgcgaagctg
caggcggtgctggacaacggcaaagcggctgaggtgtttggccggatggtcgccgcgcag
aaagggccgaccgacttagtggaaaattacgcgaaatatctgccgtcggcgatgctcagc
aaagcggtctatgccgataccgaaggctttgtgtcggcgatggatacccgtgcgctgggc
atggcggtagtgtcaatgggcggcgggcgtcgccaggcgtccgatagcattgattacagc
gtcggctttaccgatatggttcgcctgggcgacggcgttgacggacagcgtccgctggcg
gtcatccacgccaaagatgaagcctgctggcaggatgcggcgcaggcggtgaaagcggca
attactcttgacgataaagcgcctgaaattacgccaacggtctatcgtcgtattaccgaa
tag

DBGET integrated database retrieval system