KEGG   Citrobacter rodentium: ROD_50491Help
Entry
ROD_50491         CDS       T01145                                 

Gene name
speB
Definition
agmatinase (agmatine ureohydrolase) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cro  Citrobacter rodentium
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ROD_50491 (speB)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ROD_50491 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5299844..5300764
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPLNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPNEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRSVEDILAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcagtatgataactccctggtttccaacgcctttggttttctg
cgtttgccgctgaacttccagccttacgacagcgatgccgactgggtgatcaccggcgta
ccgtttgatatggcgacgtcaggacgtgcgggtggccgtcatggtccggcggcgatccgt
caggtatccaccaacctcgcctgggagcacaaccgtttcccgtggaacttcgacatgcgc
gagcgtctgaacgtggtggactgcggcgatctggtttacgcgttcggcgatgcgcgtgaa
atgagtgaaaaactgcaggcgcacgcggagaaactgctggcggctggcaagcgtatgctc
tcttttggcggcgaccattttgtcaccctgccgctgctgcgcgcccacgcaaagcacttc
ggtaaaatggcgctggtgcactttgatgcccataccgacacctacgccaacggctgcgag
tttgaccacggcaccatgttctataccgcgccgaatgaaggtctgatcgatccaaatcac
tcggtgcagatcggtattcgtaccgagttcgacaaagacaacggctttaccgtgctggat
gcctgtcaggtgaacgatcgcagcgtggaagatatcctcgcccaggtgaaacagattgtc
ggcgatatgccggtttacctgacttttgacatcgactgtctggatccggcgtttgcgcct
gggaccggtacgccggttatcggcggtttgacctccgatcgtgcgattaagctggtgcgt
gggttgaaggatctgaacatcgtcgggatggacgtggtggaagtagcgccggcttatgac
cagtccgaaatcaccgcgctggccgcagcgaccctggcgttagagatgctctatatccag
gcggcgaagaaaggcgagtaa

DBGET integrated database retrieval system