KEGG   Citrobacter rodentium: ROD_50521Help
Entry
ROD_50521         CDS       T01145                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cro  Citrobacter rodentium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROD_50521 (tpiA)
   01230 Biosynthesis of amino acids
    ROD_50521 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_50521 (tpiA)
   00051 Fructose and mannose metabolism
    ROD_50521 (tpiA)
   00562 Inositol phosphate metabolism
    ROD_50521 (tpiA)
Enzymes [BR:cro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ROD_50521 (tpiA)
Exosome [BR:cro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ROD_50521 (tpiA)
  Exosomal proteins of bladder cancer cells
   ROD_50521 (tpiA)
  Exosomal proteins of melanoma cells
   ROD_50521 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5304045..5304839)
Genome map
AA seq 264 aa AA seqDB search
MEQIWLGTSWKMNKPLSEALAWCETLAQRLPGVLHPSIQPFVIPPFTAIHPVSQYLKQHQ
IACLTGAQNMHEMENGAWTGEISAAMLAETGATLVELGHSERRGAFNETDAAINQKVHSA
LRHGLRPLICIGDSADEKRWQVSRETVVRQMKIALYGLSEQQVLQTLVAYEPVWAIGEHG
TPATPEQAAEIHRALRQALCETFGRETGLRIPLLYGGSVNRQNAVELLRQDDINGLFIGR
SAWDANGYCDIVQRVKEEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatctggttaggaaccagctggaagatgaacaagccgttgtcagaagccttg
gcctggtgtgaaacgctggcgcagcggctgccgggggttttgcatccgtcgatccagccg
ttcgttattcccccttttaccgccattcatccggtcagccagtatctgaagcaacatcag
atcgcctgtctgaccggagcgcagaatatgcatgaaatggaaaacggcgcctggaccggt
gaaatctccgccgcgatgctggctgaaaccggggcaacgctggttgaactcggtcactcc
gaacgccgcggcgcgttcaatgaaaccgacgccgctatcaaccaaaaggtgcacagcgcc
ctgcgccacggtctgcggccgctgatctgcataggcgacagcgccgatgaaaaacgctgg
caggtatcgcgagaaaccgtcgtgcggcaaatgaaaatcgccctgtatggattaagcgaa
cagcaggttttacagaccctggtcgcctacgaaccggtatgggccatcggcgaacacggc
actccggcgacgccggaacaggccgcagagatccaccgggcgctgcgccaggcgttatgc
gaaaccttcggcagagaaaccgggctgcgtattccgctgctctatggcggtagcgtcaat
cggcaaaatgccgtagagcttctccgccaggacgacatcaacgggctgtttattggtcgt
tcggcctgggatgccaacggctattgtgacattgtgcaacgcgttaaagaggaatttatt
cttcaggcgcaatag

DBGET integrated database retrieval system