KEGG   Citrobacter rodentium: ROD_50521Help
Entry
ROD_50521         CDS       T01145                                 

Gene name
tpiA
Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cro  Citrobacter rodentium
Pathway
cro00010  Glycolysis / Gluconeogenesis
cro00051  Fructose and mannose metabolism
cro00562  Inositol phosphate metabolism
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01130  Biosynthesis of antibiotics
cro01200  Carbon metabolism
cro01230  Biosynthesis of amino acids
Module
cro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cro_M00002  Glycolysis, core module involving three-carbon compounds
cro_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_50521 (tpiA)
   00051 Fructose and mannose metabolism
    ROD_50521 (tpiA)
   00562 Inositol phosphate metabolism
    ROD_50521 (tpiA)
Enzymes [BR:cro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ROD_50521 (tpiA)
Exosome [BR:cro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ROD_50521 (tpiA)
  Exosomal proteins of bladder cancer cells
   ROD_50521 (tpiA)
  Exosomal proteins of melanoma cells
   ROD_50521 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CO_dh
Motif
Other DBs
NCBI-ProteinID: CBG91725
UniProt: D2TTM2
Position
complement(5304045..5304839)
Genome map
AA seq 264 aa AA seqDB search
MEQIWLGTSWKMNKPLSEALAWCETLAQRLPGVLHPSIQPFVIPPFTAIHPVSQYLKQHQ
IACLTGAQNMHEMENGAWTGEISAAMLAETGATLVELGHSERRGAFNETDAAINQKVHSA
LRHGLRPLICIGDSADEKRWQVSRETVVRQMKIALYGLSEQQVLQTLVAYEPVWAIGEHG
TPATPEQAAEIHRALRQALCETFGRETGLRIPLLYGGSVNRQNAVELLRQDDINGLFIGR
SAWDANGYCDIVQRVKEEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatctggttaggaaccagctggaagatgaacaagccgttgtcagaagccttg
gcctggtgtgaaacgctggcgcagcggctgccgggggttttgcatccgtcgatccagccg
ttcgttattcccccttttaccgccattcatccggtcagccagtatctgaagcaacatcag
atcgcctgtctgaccggagcgcagaatatgcatgaaatggaaaacggcgcctggaccggt
gaaatctccgccgcgatgctggctgaaaccggggcaacgctggttgaactcggtcactcc
gaacgccgcggcgcgttcaatgaaaccgacgccgctatcaaccaaaaggtgcacagcgcc
ctgcgccacggtctgcggccgctgatctgcataggcgacagcgccgatgaaaaacgctgg
caggtatcgcgagaaaccgtcgtgcggcaaatgaaaatcgccctgtatggattaagcgaa
cagcaggttttacagaccctggtcgcctacgaaccggtatgggccatcggcgaacacggc
actccggcgacgccggaacaggccgcagagatccaccgggcgctgcgccaggcgttatgc
gaaaccttcggcagagaaaccgggctgcgtattccgctgctctatggcggtagcgtcaat
cggcaaaatgccgtagagcttctccgccaggacgacatcaacgggctgtttattggtcgt
tcggcctgggatgccaacggctattgtgacattgtgcaacgcgttaaagaggaatttatt
cttcaggcgcaatag

DBGET integrated database retrieval system