KEGG   Citrobacter rodentium: ROD_50521Help
Entry
ROD_50521         CDS       T01145                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cro  Citrobacter rodentium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cro01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cro01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cro00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cro00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cro00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5304045..5304839)
Genome map
AA seq 264 aa AA seqDB search
MEQIWLGTSWKMNKPLSEALAWCETLAQRLPGVLHPSIQPFVIPPFTAIHPVSQYLKQHQ
IACLTGAQNMHEMENGAWTGEISAAMLAETGATLVELGHSERRGAFNETDAAINQKVHSA
LRHGLRPLICIGDSADEKRWQVSRETVVRQMKIALYGLSEQQVLQTLVAYEPVWAIGEHG
TPATPEQAAEIHRALRQALCETFGRETGLRIPLLYGGSVNRQNAVELLRQDDINGLFIGR
SAWDANGYCDIVQRVKEEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatctggttaggaaccagctggaagatgaacaagccgttgtcagaagccttg
gcctggtgtgaaacgctggcgcagcggctgccgggggttttgcatccgtcgatccagccg
ttcgttattcccccttttaccgccattcatccggtcagccagtatctgaagcaacatcag
atcgcctgtctgaccggagcgcagaatatgcatgaaatggaaaacggcgcctggaccggt
gaaatctccgccgcgatgctggctgaaaccggggcaacgctggttgaactcggtcactcc
gaacgccgcggcgcgttcaatgaaaccgacgccgctatcaaccaaaaggtgcacagcgcc
ctgcgccacggtctgcggccgctgatctgcataggcgacagcgccgatgaaaaacgctgg
caggtatcgcgagaaaccgtcgtgcggcaaatgaaaatcgccctgtatggattaagcgaa
cagcaggttttacagaccctggtcgcctacgaaccggtatgggccatcggcgaacacggc
actccggcgacgccggaacaggccgcagagatccaccgggcgctgcgccaggcgttatgc
gaaaccttcggcagagaaaccgggctgcgtattccgctgctctatggcggtagcgtcaat
cggcaaaatgccgtagagcttctccgccaggacgacatcaacgggctgtttattggtcgt
tcggcctgggatgccaacggctattgtgacattgtgcaacgcgttaaagaggaatttatt
cttcaggcgcaatag

DBGET integrated database retrieval system