KEGG   Citrobacter rodentium: ROD_50521Help
Entry
ROD_50521         CDS       T01145                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cro  Citrobacter rodentium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROD_50521 (tpiA)
   01230 Biosynthesis of amino acids
    ROD_50521 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_50521 (tpiA)
   00051 Fructose and mannose metabolism
    ROD_50521 (tpiA)
   00562 Inositol phosphate metabolism
    ROD_50521 (tpiA)
Enzymes [BR:cro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ROD_50521 (tpiA)
Exosome [BR:cro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ROD_50521 (tpiA)
  Exosomal proteins of bladder cancer cells
   ROD_50521 (tpiA)
  Exosomal proteins of melanoma cells
   ROD_50521 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5304045..5304839)
Genome map
AA seq 264 aa AA seqDB search
MEQIWLGTSWKMNKPLSEALAWCETLAQRLPGVLHPSIQPFVIPPFTAIHPVSQYLKQHQ
IACLTGAQNMHEMENGAWTGEISAAMLAETGATLVELGHSERRGAFNETDAAINQKVHSA
LRHGLRPLICIGDSADEKRWQVSRETVVRQMKIALYGLSEQQVLQTLVAYEPVWAIGEHG
TPATPEQAAEIHRALRQALCETFGRETGLRIPLLYGGSVNRQNAVELLRQDDINGLFIGR
SAWDANGYCDIVQRVKEEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatctggttaggaaccagctggaagatgaacaagccgttgtcagaagccttg
gcctggtgtgaaacgctggcgcagcggctgccgggggttttgcatccgtcgatccagccg
ttcgttattcccccttttaccgccattcatccggtcagccagtatctgaagcaacatcag
atcgcctgtctgaccggagcgcagaatatgcatgaaatggaaaacggcgcctggaccggt
gaaatctccgccgcgatgctggctgaaaccggggcaacgctggttgaactcggtcactcc
gaacgccgcggcgcgttcaatgaaaccgacgccgctatcaaccaaaaggtgcacagcgcc
ctgcgccacggtctgcggccgctgatctgcataggcgacagcgccgatgaaaaacgctgg
caggtatcgcgagaaaccgtcgtgcggcaaatgaaaatcgccctgtatggattaagcgaa
cagcaggttttacagaccctggtcgcctacgaaccggtatgggccatcggcgaacacggc
actccggcgacgccggaacaggccgcagagatccaccgggcgctgcgccaggcgttatgc
gaaaccttcggcagagaaaccgggctgcgtattccgctgctctatggcggtagcgtcaat
cggcaaaatgccgtagagcttctccgccaggacgacatcaacgggctgtttattggtcgt
tcggcctgggatgccaacggctattgtgacattgtgcaacgcgttaaagaggaatttatt
cttcaggcgcaatag

DBGET integrated database retrieval system