KEGG   Candidatus Carsonella ruddii PV (Pachypsylla venusta): CRP_017Help
Entry
CRP_017           CDS       T00403                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
crp  Candidatus Carsonella ruddii PV (Pachypsylla venusta)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CRP_017
  Amino acid metabolism
   00300 Lysine biosynthesis
    CRP_017
Enzymes [BR:crp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CRP_017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(14072..15115)
Genome map
AA seq 347 aa AA seqDB search
MILFFNSLKKILFKSLSYCCKKIFLIIIKYFKLINIELIKIRKVINLHLFNISYSYLYIS
HIDTVHESNVKWLKNPFSSYLFKKKIINRGIIDMKGSFISVLFFNKNILNFILTNDEESV
SIYGIQYSISLLSARKKKFFFFFGTEPTSENIIGDYLKISRRGSFNLKIIFLGKIKHCAY
LGKNLIKMLFSFFFLKKDIKKNILEYTNIFCGNNTDNLLSNKLFLKLNLRFNSFYSIFVL
KKKFLFFLKSKNVYINWNLSGIPFLCYKNFYLIKILNIINTIQNIKTKINFLGGTSDLRY
CFYTYYNSEIFEFGLINKSIHKINENCFLDDCFILSIIFYFFLNGIK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgattttattttttaattctttaaaaaaaattttatttaaaagtttatcatattgttgt
aaaaaaatttttttaataattataaaatactttaaattgataaatatagaattaataaaa
attagaaaagtaataaacttacacttatttaatataagttatagttatttgtatatatct
cacatagatacagtacatgaaagtaatgttaaatggttaaaaaatccattttcaagttat
ttatttaaaaaaaaaataataaatagaggtataatagatatgaaaggttctttcattagt
gttttgttttttaataaaaatattctaaattttattttaactaatgatgaagaatctgtt
tctatttatggaatacaatatagtattagtttattgagtgcaagaaaaaaaaaatttttt
tttttttttggcacagaaccaacttctgaaaatataataggtgattatcttaaaatatct
agaagaggatcttttaatttaaaaattatttttttaggaaaaataaaacattgtgcttat
ttaggtaaaaatttaataaaaatgttgtttagttttttttttttaaagaaagatattaaa
aaaaatattttagagtatacaaatattttttgtggcaataatacagacaatttgttatct
aataaattatttttaaaactaaacttaaggtttaatagtttttatagcatttttgtttta
aaaaaaaaatttttattttttttaaaatcaaaaaatgtttatataaattggaatttaagt
ggaattccgtttttatgttataaaaacttttatttaataaaaattttaaatattattaat
acaattcaaaatattaaaacaaaaataaattttttaggaggtacatctgatttaagatat
tgtttttatacttattataattctgagatatttgaatttggtttaataaacaaatcaatt
cataaaataaatgaaaattgttttttagatgattgttttattttatctattatattttat
ttttttttgaatgggattaaatag

DBGET integrated database retrieval system