KEGG   Candidatus Carsonella ruddii PV (Pachypsylla venusta): CRP_100Help
Entry
CRP_100           CDS       T00403                                 

Definition
succinyl-CoA synthetase beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
crp  Candidatus Carsonella ruddii PV (Pachypsylla venusta)
Pathway
Citrate cycle (TCA cycle)
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRP_100
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRP_100
   00640 Propanoate metabolism
    CRP_100
   00660 C5-Branched dibasic acid metabolism
    CRP_100
Enzymes [BR:crp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CRP_100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91313..92350)
Genome map
AA seq 345 aa AA seqDB search
MNLCEFESKKILFKYNLPILNSYLTSNYTYVKNYIYKIQVNLNYRKKKGGILIPHSKNEL
KVFYKKWKKTKFNNKKIKYFLLEKISKIEIEFFLSFFVHDNNLTIIISNKGGINVELENK
NYFLKLNIKTFIVFYSIYDYLLNCKIFKKNILSILNLVFKLYKIIICNNLLLVEINPLIV
YKKKIYILDCKIITEKIKKENFSDNISNILKINYIKLKGNICCIVNGAGLALKTLDILSF
NNLKCANFIDLSGSITEVNINNLLKVILIDKKLNFLLINIFGGIVSCEKILIGFLNIFYY
DFNFKIIIKLNGLKSKLALKKIIILKKIIIIKNYKKLFYKCKITR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatgtgaatttgaatcaaagaaaattttgtttaaatataatttaccaatttta
aattcatatttaacaagtaattatacatacgttaaaaactatatttataaaatacaagtt
aatttaaactatagaaaaaaaaaaggaggtatattaatacctcattcaaaaaatgaatta
aaagtattttataaaaaatggaaaaaaacaaaatttaataataaaaaaattaagtatttt
ttattagaaaaaatttcaaaaattgaaatagaatttttcttatctttttttgttcatgat
aataatttaactattattattagtaacaagggtggaattaatgttgaattagaaaataaa
aattattttttaaaattaaacataaaaacttttatagtattttattcaatatatgattat
ttattaaattgcaaaatttttaaaaaaaatattttaagtattttaaatttagtttttaaa
ctttacaaaattataatatgtaataatttattattagtagaaattaatcctttaatagtc
tataaaaaaaaaatttatattttagattgcaaaattataacagaaaaaattaaaaaagaa
aatttctcggacaatatttctaacattttaaaaataaattatataaaattaaaaggtaat
atttgttgtattgtaaatggtgctggattagcacttaaaactttagatattttatctttt
aataatttaaaatgtgcaaactttattgatttaagcggttcgataacagaagttaatata
aataatttacttaaagtaattttaatcgataagaaattaaattttttattaattaatata
tttggtggaattgtatcttgtgaaaaaatacttattggttttttaaacatattttattat
gattttaattttaaaattattattaaattaaatggtttaaaatcaaaattagcattaaaa
aaaataattattcttaaaaaaataataataattaaaaattacaaaaagttattttataaa
tgtaaaattacgagatga

DBGET integrated database retrieval system