KEGG   Candidatus Carsonella ruddii PV (Pachypsylla venusta): CRP_100Help
Entry
CRP_100           CDS       T00403                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
crp  Candidatus Carsonella ruddii PV (Pachypsylla venusta)
Pathway
crp00020  Citrate cycle (TCA cycle)
crp00660  C5-Branched dibasic acid metabolism
crp01100  Metabolic pathways
crp01110  Biosynthesis of secondary metabolites
crp01120  Microbial metabolism in diverse environments
crp01130  Biosynthesis of antibiotics
crp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRP_100
   00640 Propanoate metabolism
    CRP_100
   00660 C5-Branched dibasic acid metabolism
    CRP_100
Enzymes [BR:crp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CRP_100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BAF35131
UniProt: Q05FP0
Position
complement(91313..92350)
Genome map
AA seq 345 aa AA seqDB search
MNLCEFESKKILFKYNLPILNSYLTSNYTYVKNYIYKIQVNLNYRKKKGGILIPHSKNEL
KVFYKKWKKTKFNNKKIKYFLLEKISKIEIEFFLSFFVHDNNLTIIISNKGGINVELENK
NYFLKLNIKTFIVFYSIYDYLLNCKIFKKNILSILNLVFKLYKIIICNNLLLVEINPLIV
YKKKIYILDCKIITEKIKKENFSDNISNILKINYIKLKGNICCIVNGAGLALKTLDILSF
NNLKCANFIDLSGSITEVNINNLLKVILIDKKLNFLLINIFGGIVSCEKILIGFLNIFYY
DFNFKIIIKLNGLKSKLALKKIIILKKIIIIKNYKKLFYKCKITR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatgtgaatttgaatcaaagaaaattttgtttaaatataatttaccaatttta
aattcatatttaacaagtaattatacatacgttaaaaactatatttataaaatacaagtt
aatttaaactatagaaaaaaaaaaggaggtatattaatacctcattcaaaaaatgaatta
aaagtattttataaaaaatggaaaaaaacaaaatttaataataaaaaaattaagtatttt
ttattagaaaaaatttcaaaaattgaaatagaatttttcttatctttttttgttcatgat
aataatttaactattattattagtaacaagggtggaattaatgttgaattagaaaataaa
aattattttttaaaattaaacataaaaacttttatagtattttattcaatatatgattat
ttattaaattgcaaaatttttaaaaaaaatattttaagtattttaaatttagtttttaaa
ctttacaaaattataatatgtaataatttattattagtagaaattaatcctttaatagtc
tataaaaaaaaaatttatattttagattgcaaaattataacagaaaaaattaaaaaagaa
aatttctcggacaatatttctaacattttaaaaataaattatataaaattaaaaggtaat
atttgttgtattgtaaatggtgctggattagcacttaaaactttagatattttatctttt
aataatttaaaatgtgcaaactttattgatttaagcggttcgataacagaagttaatata
aataatttacttaaagtaattttaatcgataagaaattaaattttttattaattaatata
tttggtggaattgtatcttgtgaaaaaatacttattggttttttaaacatattttattat
gattttaattttaaaattattattaaattaaatggtttaaaatcaaaattagcattaaaa
aaaataattattcttaaaaaaataataataattaaaaattacaaaaagttattttataaa
tgtaaaattacgagatga

DBGET integrated database retrieval system