KEGG   Candidatus Carsonella ruddii PV: CRP_120Help
Entry
CRP_120           CDS       T00403                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
crp  Candidatus Carsonella ruddii PV (Pachypsylla venusta)
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CRP_120
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRP_120
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CRP_120
Enzymes [BR:crp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CRP_120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(113517..114821)
Genome map
AA seq 434 aa AA seqDB search
MYYNSINNKLNIKNFISIFLNNIPKDKTLFFPFKIPKISKKYFSFLKNKSYIDFSFYISK
YFIDYINDEKLYNILNNSYLKFNNEIIKLESLNDNYILNLNTGKTLAFKDIALVPLGFLL
NFVSKIINKKIIIFCATSGDTGSAAINSFKNFNNIKLFTFFPFNMISDIQRKQITTIKRN
NIHNISLIGNFDSAQFLIKKIFENLKLFKKNFLVSVNSINWFRIVLQTVYYCFSSLKLFK
NNLINYYVPTGNFGNALSVYVAKKMGFPIGKIIVCNNDNYYIDNFLKYENIQNNFFKKTI
SPSIDITIPSNFIRIINVYKYKIKKLNEINSIFFSDKIYNRYIILSLEFFYLKYKKIYDP
HTITSLTSLIKENLKFNNVVVSTAYPIKFFFSIKKIIPSIKLNFKFKKTFKLVESYKIFS
LNYNLILNYVKKKI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtattacaatagtattaataataaattaaacataaaaaattttataagcatattttta
aataatattccaaaagataaaactttattttttccatttaaaataccaaaaataagtaaa
aaatacttttcttttttaaaaaataaatcatatattgatttttctttttatatttcaaaa
tattttatagattatattaatgatgaaaaactttataatattttaaacaatagttattta
aaatttaataatgaaattataaaattggaatcactaaatgataattatatattaaattta
aatactggcaaaactttagcttttaaagatattgcccttgttccattaggttttttatta
aattttgtgtctaaaataataaataaaaaaataataattttttgtgcaacttcgggagat
actggttctgctgctattaatagttttaaaaactttaacaatattaaattgtttactttt
tttccttttaatatgatatcagacattcaaagaaaacaaataactactattaaaagaaat
aatattcataatatttcattaatcggaaattttgattctgctcaatttttaattaaaaaa
atttttgaaaatttaaaattgtttaaaaaaaattttttagtatctgttaattctataaat
tggttcagaattgtattacaaacagtgtattattgtttttcttcacttaaattatttaaa
aataatttaattaattattacgttccaactggaaattttggaaatgctttatctgtttac
gttgcaaaaaaaatgggttttcctattggaaaaataatcgtttgtaataatgataattat
tatattgataattttttaaagtatgaaaatattcaaaataatttttttaaaaaaactatt
tcaccttctattgatattacaataccgtctaattttataagaattattaatgtttataaa
tataaaattaaaaaattaaatgaaattaatagtatttttttttctgataaaatttataat
aggtatataattttatctttagaatttttttatttgaagtataaaaaaatatatgatccg
catacaattacaagtttaacatctttaataaaagaaaatttaaaatttaataatgtagta
gtttcaacagcttatcctattaagttttttttttctataaaaaaaataatacctagtata
aaattaaattttaaatttaaaaaaacttttaaattagttgaaagctataagattttttca
ttaaactataatttaatattaaattatgtaaaaaaaaaaatatga

DBGET integrated database retrieval system