KEGG   Candidatus Carsonella ruddii PV (Pachypsylla venusta): CRP_120Help
Entry
CRP_120           CDS       T00403                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
crp  Candidatus Carsonella ruddii PV (Pachypsylla venusta)
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CRP_120
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRP_120
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CRP_120
Enzymes [BR:crp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CRP_120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(113517..114821)
Genome map
AA seq 434 aa AA seqDB search
MYYNSINNKLNIKNFISIFLNNIPKDKTLFFPFKIPKISKKYFSFLKNKSYIDFSFYISK
YFIDYINDEKLYNILNNSYLKFNNEIIKLESLNDNYILNLNTGKTLAFKDIALVPLGFLL
NFVSKIINKKIIIFCATSGDTGSAAINSFKNFNNIKLFTFFPFNMISDIQRKQITTIKRN
NIHNISLIGNFDSAQFLIKKIFENLKLFKKNFLVSVNSINWFRIVLQTVYYCFSSLKLFK
NNLINYYVPTGNFGNALSVYVAKKMGFPIGKIIVCNNDNYYIDNFLKYENIQNNFFKKTI
SPSIDITIPSNFIRIINVYKYKIKKLNEINSIFFSDKIYNRYIILSLEFFYLKYKKIYDP
HTITSLTSLIKENLKFNNVVVSTAYPIKFFFSIKKIIPSIKLNFKFKKTFKLVESYKIFS
LNYNLILNYVKKKI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtattacaatagtattaataataaattaaacataaaaaattttataagcatattttta
aataatattccaaaagataaaactttattttttccatttaaaataccaaaaataagtaaa
aaatacttttcttttttaaaaaataaatcatatattgatttttctttttatatttcaaaa
tattttatagattatattaatgatgaaaaactttataatattttaaacaatagttattta
aaatttaataatgaaattataaaattggaatcactaaatgataattatatattaaattta
aatactggcaaaactttagcttttaaagatattgcccttgttccattaggttttttatta
aattttgtgtctaaaataataaataaaaaaataataattttttgtgcaacttcgggagat
actggttctgctgctattaatagttttaaaaactttaacaatattaaattgtttactttt
tttccttttaatatgatatcagacattcaaagaaaacaaataactactattaaaagaaat
aatattcataatatttcattaatcggaaattttgattctgctcaatttttaattaaaaaa
atttttgaaaatttaaaattgtttaaaaaaaattttttagtatctgttaattctataaat
tggttcagaattgtattacaaacagtgtattattgtttttcttcacttaaattatttaaa
aataatttaattaattattacgttccaactggaaattttggaaatgctttatctgtttac
gttgcaaaaaaaatgggttttcctattggaaaaataatcgtttgtaataatgataattat
tatattgataattttttaaagtatgaaaatattcaaaataatttttttaaaaaaactatt
tcaccttctattgatattacaataccgtctaattttataagaattattaatgtttataaa
tataaaattaaaaaattaaatgaaattaatagtatttttttttctgataaaatttataat
aggtatataattttatctttagaatttttttatttgaagtataaaaaaatatatgatccg
catacaattacaagtttaacatctttaataaaagaaaatttaaaatttaataatgtagta
gtttcaacagcttatcctattaagttttttttttctataaaaaaaataatacctagtata
aaattaaattttaaatttaaaaaaacttttaaattagttgaaagctataagattttttca
ttaaactataatttaatattaaattatgtaaaaaaaaaaatatga

DBGET integrated database retrieval system