KEGG   Candidatus Carsonella ruddii HT isolate Thao2000: A355_0123Help
Entry
A355_0123         CDS       T02196                                 

Definition
hypothetical protein
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
crt  Candidatus Carsonella ruddii HT isolate Thao2000
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:crt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:crt00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:crt00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:crt00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:crt00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:crt00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94347..94529
Genome map
AA seq 60 aa AA seqDB search
MKIKNFLIYNHKNIVKNCINCNYCIIFCPKNKIYKKKKKIFFKCNFCKYCNINCKNNCIN
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaattttttaatttataatcataaaaatattgttaaaaattgtataaat
tgtaattattgtattattttttgtccaaaaaataaaatttataaaaaaaaaaaaaaaatt
ttttttaaatgtaatttttgtaaatattgcaatataaattgtaaaaacaattgcattaat
taa

DBGET integrated database retrieval system