KEGG   Candidatus Carsonella ruddii HT (Heteropsylla texana): A355_0123Help
Entry
A355_0123         CDS       T02196                                 

Definition
hypothetical protein
Organism
crt  Candidatus Carsonella ruddii HT (Heteropsylla texana)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94347..94529
Genome map
AA seq 60 aa AA seqDB search
MKIKNFLIYNHKNIVKNCINCNYCIIFCPKNKIYKKKKKIFFKCNFCKYCNINCKNNCIN
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaattttttaatttataatcataaaaatattgttaaaaattgtataaat
tgtaattattgtattattttttgtccaaaaaataaaatttataaaaaaaaaaaaaaaatt
ttttttaaatgtaatttttgtaaatattgcaatataaattgtaaaaacaattgcattaat
taa

DBGET integrated database retrieval system