KEGG   Candidatus Carsonella ruddii HT isolate Thao2000: A355_0147Help
Entry
A355_0147         CDS       T02196                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
crt  Candidatus Carsonella ruddii HT isolate Thao2000
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:crt01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:crt00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(112694..113998)
Genome map
AA seq 434 aa AA seqDB search
MYYNSINNKLNIKNFCDIFFTNIPKNKTLFFPFKIPFFRSKQLNYLKNLNYINFAFEISK
LFLNNISDEDLYNILHISYYNKKILNLIKLNNNNYLLNLNNGNTLTFKDIAMLPLSNLIK
YFSFKNKKKMIIFCATSGDTGSSANNSFKNIINTKIFTFFPFNMISNIQKKQITTLNFKN
IFNYSIIGNFDISQHFVKKIFENIKNNEKISLLSVNSINWFRIIMQIVYYCYISIKNFNN
NKFDFIIPSGNFGNALAAVLSKKMGFPINKIISCTNDNFYLDNYIKNNKIENFILKKTIA
PSIDITIPSNFIRLMNNNCLKKKTINDINKNVFSDKIYNKNIISSIEYFYQIYNKIYDPH
TIISLCSLYKEKIDNQIVVSTSYPIKFIFSIKKIIPNIKIKTNIKKIFFLKEKFKIYPQN
FLIIINSIKNNINV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtattacaatagtataaataataaattaaatattaaaaatttttgtgatatttttttt
accaatataccaaaaaataaaactttattttttccttttaaaataccattttttagaagt
aaacaattaaattatttaaaaaatttaaattatataaattttgcttttgaaatttcaaaa
ttgtttttaaataatatatcagatgaagatttatataatatattacatattagttattac
aataaaaaaatattaaacttaataaaattaaataataataattatttattaaatttaaat
aatggaaatactttaacttttaaagatatagctatgttgccattatcaaatttaataaaa
tatttttcttttaaaaataaaaaaaaaatgattattttttgtgctacttctggtgataca
ggatcatcagctaataattcttttaaaaatattattaatacaaaaatttttacttttttt
ccatttaatatgatttctaatattcaaaaaaaacaaataactactttaaattttaaaaat
atatttaattattcaataataggtaattttgatattagtcaacattttgttaaaaaaata
tttgaaaatataaaaaataatgaaaaaatttcattattatctgtaaattcaataaattgg
tttagaataataatgcaaatagtatattattgctatatttcaattaaaaattttaataat
aataaatttgattttatcataccatcaggtaattttggtaatgctttagcagcagtttta
tcaaaaaaaatgggttttcctattaataaaataatttcttgtacaaatgataatttttat
ttagataattatataaaaaataataaaattgaaaattttattttaaaaaaaactatcgct
ccttcaattgatataacaattccttcaaattttataagattaatgaataataattgttta
aaaaaaaaaacaataaatgatataaataaaaatgttttttctgataaaatttacaataaa
aatataattagttcaatagaatatttttatcaaatatataataaaatttatgatcctcat
acaattatatcactttgttcattatataaagaaaaaatagacaatcaaatagttgtatca
acttcttatcctataaaatttatattttcaattaaaaaaataatacctaatattaaaata
aaaactaatattaaaaaaattttttttttaaaagaaaaatttaaaatttatcctcagaat
tttttaattattataaattctataaaaaataatatcaatgtataa

DBGET integrated database retrieval system