KEGG   Candidatus Carsonella ruddii HT (Heteropsylla texana): A355_0147Help
Entry
A355_0147         CDS       T02196                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
crt  Candidatus Carsonella ruddii HT (Heteropsylla texana)
Pathway
crt00260  Glycine, serine and threonine metabolism
crt01100  Metabolic pathways
crt01110  Biosynthesis of secondary metabolites
crt01120  Microbial metabolism in diverse environments
crt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A355_0147 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A355_0147 (thrC)
Enzymes [BR:crt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A355_0147 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFP84167
UniProt: J3TEI1
Position
complement(112694..113998)
Genome map
AA seq 434 aa AA seqDB search
MYYNSINNKLNIKNFCDIFFTNIPKNKTLFFPFKIPFFRSKQLNYLKNLNYINFAFEISK
LFLNNISDEDLYNILHISYYNKKILNLIKLNNNNYLLNLNNGNTLTFKDIAMLPLSNLIK
YFSFKNKKKMIIFCATSGDTGSSANNSFKNIINTKIFTFFPFNMISNIQKKQITTLNFKN
IFNYSIIGNFDISQHFVKKIFENIKNNEKISLLSVNSINWFRIIMQIVYYCYISIKNFNN
NKFDFIIPSGNFGNALAAVLSKKMGFPINKIISCTNDNFYLDNYIKNNKIENFILKKTIA
PSIDITIPSNFIRLMNNNCLKKKTINDINKNVFSDKIYNKNIISSIEYFYQIYNKIYDPH
TIISLCSLYKEKIDNQIVVSTSYPIKFIFSIKKIIPNIKIKTNIKKIFFLKEKFKIYPQN
FLIIINSIKNNINV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtattacaatagtataaataataaattaaatattaaaaatttttgtgatatttttttt
accaatataccaaaaaataaaactttattttttccttttaaaataccattttttagaagt
aaacaattaaattatttaaaaaatttaaattatataaattttgcttttgaaatttcaaaa
ttgtttttaaataatatatcagatgaagatttatataatatattacatattagttattac
aataaaaaaatattaaacttaataaaattaaataataataattatttattaaatttaaat
aatggaaatactttaacttttaaagatatagctatgttgccattatcaaatttaataaaa
tatttttcttttaaaaataaaaaaaaaatgattattttttgtgctacttctggtgataca
ggatcatcagctaataattcttttaaaaatattattaatacaaaaatttttacttttttt
ccatttaatatgatttctaatattcaaaaaaaacaaataactactttaaattttaaaaat
atatttaattattcaataataggtaattttgatattagtcaacattttgttaaaaaaata
tttgaaaatataaaaaataatgaaaaaatttcattattatctgtaaattcaataaattgg
tttagaataataatgcaaatagtatattattgctatatttcaattaaaaattttaataat
aataaatttgattttatcataccatcaggtaattttggtaatgctttagcagcagtttta
tcaaaaaaaatgggttttcctattaataaaataatttcttgtacaaatgataatttttat
ttagataattatataaaaaataataaaattgaaaattttattttaaaaaaaactatcgct
ccttcaattgatataacaattccttcaaattttataagattaatgaataataattgttta
aaaaaaaaaacaataaatgatataaataaaaatgttttttctgataaaatttacaataaa
aatataattagttcaatagaatatttttatcaaatatataataaaatttatgatcctcat
acaattatatcactttgttcattatataaagaaaaaatagacaatcaaatagttgtatca
acttcttatcctataaaatttatattttcaattaaaaaaataatacctaatattaaaata
aaaactaatattaaaaaaattttttttttaaaagaaaaatttaaaatttatcctcagaat
tttttaattattataaattctataaaaaataatatcaatgtataa

DBGET integrated database retrieval system