KEGG   Candidatus Carsonella ruddii CE (Ctenarytaina eucalypti): A33U_0155Help
Entry
A33U_0155         CDS       T02194                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cru  Candidatus Carsonella ruddii CE (Ctenarytaina eucalypti)
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A33U_0155 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A33U_0155 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A33U_0155 (thrC)
Enzymes [BR:cru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A33U_0155 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(116307..117626)
Genome map
AA seq 439 aa AA seqDB search
MYYNSINNKLNIKNFINIFLKNIPKDKSLYFPFIIKKFNKFYINNLKKLNYLNFSFNIIN
KFINCISENIIYHLLKNSYNKFYNKNIINFYNLENNSYLLNLNNGPTLTFKDIALQPLGN
FLNYISKIINKKIVIFCATSGDTGSSAINSFKNYENIKLIIFHPFNMISNIQRKQMTTII
RNNIYNISILGNFDFTQHIIKNIFENIKKYKNYLFISVNSINWFRIILQTVYYCYSSLKL
YTNKLINYYIPSGNFGNATSAFIAKKLGFPIGKIIVCNNDNNYLDNFFKKSLLINKKLKS
TISPAIDISIPSNFKRIYNKKKIKKNDINFYNKFFYSDKILNKTIINSIEYFFNIYKKVF
DPHTITSLTSFFKNRNIHNNKIKLIVSTSYPIKFFYSIKKIIPNIKINLNIKNIFLLKEK
YKIFNQNFKIIINYIKKIL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtattataatagtattaataataaattaaatataaaaaattttataaatatattttta
aaaaatataccaaaagataaaagtttatattttccttttataataaaaaaatttaataaa
ttttatataaataatttaaaaaaattaaattatttaaatttttcttttaatataataaac
aaatttattaattgtatttcagaaaacataatttatcatcttttaaaaaattcttataat
aaattttataataaaaatataattaatttttataatttagaaaacaattcttatttatta
aatttaaataacggaccgacattaacttttaaagatattgcgttacaacctctaggaaat
tttttaaattatatttctaaaataataaataaaaaaatagtaattttttgtgctacttct
ggtgatactggttcatctgctataaatagttttaaaaattatgaaaatataaaattaata
atttttcatccttttaatatgatttctaatattcaaagaaaacaaatgacaacaattatt
agaaataatatttataatatttctatattaggaaattttgattttactcaacatattata
aaaaatatatttgaaaatataaaaaaatataaaaattatttatttatatcagtaaactct
attaattggtttagaataattttacaaacagtatattattgttattcttctttaaaattg
tatactaataaattaataaattattacattccatcaggtaattttggaaatgctacttct
gcctttatcgctaaaaaattaggttttcctattggaaaaataatagtttgtaataacgat
aataattatttagataatttttttaaaaaaagtttattaataaataaaaaattaaaatca
actatttctccagcgatagatatttctataccatcaaattttaaaagaatatataataaa
aaaaaaataaaaaaaaatgatataaatttttataataaatttttttattcagataaaatt
ttaaataaaacaattataaattctattgaatatttttttaatatatacaaaaaagtattt
gatccacatactataacttctttaacttctttttttaagaatagaaatattcataacaat
aaaataaaattaatagtatctacttcttatccaataaaatttttttattcaattaaaaaa
attattcccaatataaaaattaatttaaatataaaaaatatttttttattaaaagaaaaa
tataaaatatttaatcaaaattttaaaattattataaattatataaaaaaaatattatga

DBGET integrated database retrieval system