KEGG   Candidatus Carsonella ruddii PC isolate NHV: A357_0119Help
Entry
A357_0119         CDS       T02198                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
crv  Candidatus Carsonella ruddii PC isolate NHV
Pathway
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:crv01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle)
Metabolism; Carbohydrate metabolism; Propanoate metabolism
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:crv00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91631..92668)
Genome map
AA seq 345 aa AA seqDB search
MNLYEYESKKILLKYNLPVLNSYLTNKFLFIKNYIYKIQVDSNYRKKGGGIIIPHTKNEL
IIFYNKWIFKKFNKKLIKNFLLEKIIKIEIELFLSLYIQNDNLIIVISNKGGINVEFENK
NYFLKIKIKTFILFYSIYDYLLNCKVFKKTILNIIILIFKLYKVIIKNNILLMEINPLVI
YKKNIFILDCKIIKEGIKTRNFSDFISNILKLNYIKLKGNICCIVNGAGLALKILDIFSF
NNLKCSNFIDLSGSITEIFINNLLKMILIDKNLSFLIINIFGGIVSCEKILIGFLNIFYY
NFNFKIIIKLNGLNSKFVLKKLINLKNVIIINNYKYLFYKCKILK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatatgaatatgaatcaaaaaaaattttattaaaatataatttacctgtttta
aattcttatttaacaaataaatttttatttattaaaaattatatttataaaatacaagtt
gattcaaattatagaaaaaaaggaggaggaattataattccacatacaaaaaatgaatta
ataatattttataataaatggatttttaaaaaatttaataaaaaattaattaaaaatttt
ttattagaaaagattataaaaattgaaattgaattgtttttatcattatatatacaaaac
gataatttaattatagttattagtaataaaggtggaataaatgttgaatttgaaaataaa
aattattttttaaaaattaaaataaaaacttttatattattttattcaatatatgattat
ttgttaaactgtaaagtttttaaaaaaactattttaaatataataattttaatttttaaa
ttgtataaagttataattaaaaataatattttattgatggaaataaatccattagttatt
tataaaaaaaatatttttattttagattgtaaaataataaaagaaggaataaaaacaaga
aatttttctgattttatatcgaatattttaaaattaaattatataaaattaaaaggaaac
atatgttgtattgtaaacggtgcaggattagcacttaaaatattagatattttttctttt
aataatttaaaatgttcaaactttatcgatttaagtggttcaataacagaaatttttata
aacaatttattaaaaatgattttaatagataaaaatttaagttttttaataataaatata
tttggaggaatagtatcgtgtgaaaaaatattaatcggatttttaaatattttttactat
aattttaattttaaaataataataaaattaaatggtttaaattctaaatttgtattaaaa
aaattaattaatttaaaaaacgttataattattaataattataaatatttattttataaa
tgtaaaattttaaaatga

DBGET integrated database retrieval system