KEGG   Candidatus Carsonella ruddii PC (Pachypsylla celtidis): A357_0147Help
Entry
A357_0147         CDS       T02198                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
crv  Candidatus Carsonella ruddii PC (Pachypsylla celtidis)
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A357_0147 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A357_0147 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A357_0147 (thrC)
Enzymes [BR:crv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A357_0147 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(113744..115048)
Genome map
AA seq 434 aa AA seqDB search
MYYNSINNKLNIKSFINIFLNNIPKDKTLFFPFKIPKINKKNFYFLKKQTYIDFAFYISK
YFIDYINDENLYKILYNSYLKFNNEVIKLEFLNNNYILNLNSGKTLTFKDIALVPLGFLL
NFISKLVNKKIIIFCATSGDTGSAAINSFKNFKNIKLFTFFPFNMISDIQRKQITTIKRN
NIHNISLIGNFDSAQFLIKKIFENLKLFKKNFLVSVNSINWFRIILQTIYYCFSSLKLYN
NNLINYYVPTGNFGNALSVFIAKKMGFPIGKIIICNNDNYYIDNFLKYEKIHNNNLKKTI
SPSIDISIPSNFLRIINIYNYKIKNLNKVNKIFYSDKIYNKYIILSLEFFYLKYKKIYDP
HTITSLSSLFKENLKFCNVVVSTAYPIKFYFSIKKIIPNLKFNFKTKKIFFLNENYKVFA
LNFNLIINYIKKKI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtattataatagtattaataataaattaaacataaaaagttttataaatatttttttg
aataatattccaaaagataaaactttattttttccatttaagataccaaaaattaataaa
aaaaatttttattttttaaaaaaacaaacatatattgattttgctttttatatttcaaag
tattttatagattatattaatgatgaaaatctttataaaatattatacaatagctatttg
aaatttaataatgaagtaataaaattagaatttttaaataataattatatattaaattta
aattctggaaaaactttaacttttaaagatattgcattggttccattaggttttttatta
aattttatttctaaattagtaaataaaaaaataataattttttgtgcaacttcaggtgat
acaggatcagcagcaataaacagtttcaaaaattttaaaaatattaaattatttacattt
tttccttttaatatgatatcagatattcaaagaaaacaaataactacaataaaaagaaat
aacatacataatatttcgttaattggaaatttcgattctgctcaatttttaattaaaaaa
atttttgaaaacttaaaattatttaaaaaaaattttttagtatctgtaaattcaataaac
tggtttagaattatattacaaacaatttattattgcttttcttcattaaagttatataac
aataatttaattaattattacgttccaaccggaaattttggaaatgctttatctgttttt
attgctaaaaaaatgggatttccaataggaaaaataattatttgtaataacgataattat
tatattgataattttttaaaatatgaaaaaattcataataataatttaaagaaaacaatt
tctccttctatagatatttctataccatctaattttttaagaattattaatatttataat
tataaaattaaaaatttaaacaaagtaaataaaattttttattctgataaaatttacaat
aaatatattattttatctttagaatttttttatttaaaatataaaaaaatatatgatcct
catacaataacatctttatcttctttgtttaaagaaaatttaaaattttgtaacgttgta
gtttctacagcatatcctataaaattttatttttctattaaaaaaataatacctaattta
aaatttaattttaaaacaaaaaaaattttttttttaaatgaaaattataaagtttttgca
ttaaattttaatttaataataaattatattaaaaaaaaaatatga

DBGET integrated database retrieval system