KEGG   Candidatus Carsonella ruddii PC isolate NHV: A357_0147Help
Entry
A357_0147         CDS       T02198                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
crv  Candidatus Carsonella ruddii PC isolate NHV
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A357_0147 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A357_0147 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A357_0147 (thrC)
Enzymes [BR:crv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A357_0147 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(113744..115048)
Genome map
AA seq 434 aa AA seqDB search
MYYNSINNKLNIKSFINIFLNNIPKDKTLFFPFKIPKINKKNFYFLKKQTYIDFAFYISK
YFIDYINDENLYKILYNSYLKFNNEVIKLEFLNNNYILNLNSGKTLTFKDIALVPLGFLL
NFISKLVNKKIIIFCATSGDTGSAAINSFKNFKNIKLFTFFPFNMISDIQRKQITTIKRN
NIHNISLIGNFDSAQFLIKKIFENLKLFKKNFLVSVNSINWFRIILQTIYYCFSSLKLYN
NNLINYYVPTGNFGNALSVFIAKKMGFPIGKIIICNNDNYYIDNFLKYEKIHNNNLKKTI
SPSIDISIPSNFLRIINIYNYKIKNLNKVNKIFYSDKIYNKYIILSLEFFYLKYKKIYDP
HTITSLSSLFKENLKFCNVVVSTAYPIKFYFSIKKIIPNLKFNFKTKKIFFLNENYKVFA
LNFNLIINYIKKKI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtattataatagtattaataataaattaaacataaaaagttttataaatatttttttg
aataatattccaaaagataaaactttattttttccatttaagataccaaaaattaataaa
aaaaatttttattttttaaaaaaacaaacatatattgattttgctttttatatttcaaag
tattttatagattatattaatgatgaaaatctttataaaatattatacaatagctatttg
aaatttaataatgaagtaataaaattagaatttttaaataataattatatattaaattta
aattctggaaaaactttaacttttaaagatattgcattggttccattaggttttttatta
aattttatttctaaattagtaaataaaaaaataataattttttgtgcaacttcaggtgat
acaggatcagcagcaataaacagtttcaaaaattttaaaaatattaaattatttacattt
tttccttttaatatgatatcagatattcaaagaaaacaaataactacaataaaaagaaat
aacatacataatatttcgttaattggaaatttcgattctgctcaatttttaattaaaaaa
atttttgaaaacttaaaattatttaaaaaaaattttttagtatctgtaaattcaataaac
tggtttagaattatattacaaacaatttattattgcttttcttcattaaagttatataac
aataatttaattaattattacgttccaaccggaaattttggaaatgctttatctgttttt
attgctaaaaaaatgggatttccaataggaaaaataattatttgtaataacgataattat
tatattgataattttttaaaatatgaaaaaattcataataataatttaaagaaaacaatt
tctccttctatagatatttctataccatctaattttttaagaattattaatatttataat
tataaaattaaaaatttaaacaaagtaaataaaattttttattctgataaaatttacaat
aaatatattattttatctttagaatttttttatttaaaatataaaaaaatatatgatcct
catacaataacatctttatcttctttgtttaaagaaaatttaaaattttgtaacgttgta
gtttctacagcatatcctataaaattttatttttctattaaaaaaataatacctaattta
aaatttaattttaaaacaaaaaaaattttttttttaaatgaaaattataaagtttttgca
ttaaattttaatttaataataaattatattaaaaaaaaaatatga

DBGET integrated database retrieval system