KEGG   Candidatus Carsonella ruddii PC (Pachypsylla celtidis): A357_018Help
Entry
A357_018          CDS       T02198                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
crv  Candidatus Carsonella ruddii PC (Pachypsylla celtidis)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A357_018 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    A357_018 (dapE)
Enzymes [BR:crv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     A357_018 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(14080..15129)
Genome map
AA seq 349 aa AA seqDB search
MINFFNSLKKILFKSLSYCEKKIFLIIIKYFKLINIELIKIRKVINLYLYNNYYNYMYIS
HIDTVSESNVKWILNPFLSLLFKKKIINRGIIDMKGSFISVLFFNKKILNFILTNDEESV
SIYGIQYTLNILNIRKKKIYFFMGTEPTSENIIGDYTKISRRGSFNLKIIFLGKNKHCAY
IGKNLIKMLFKNFFFLKNDVKKFNILEYTNIFCGNNSDNFLSNKLFLKINFRFNFLRKII
ILKKKFLKFLISKNVYIVWKLSGIPFFCYKNFFLKNIFNIIYYIQNIKTKINFLGGTSDL
RYCFYIYQYSEIFELGLINKSIHKINENCFLDDCLILSIIFYYFIYGIK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttttttaattctttaaaaaaaatattgtttaaaagtttatcttattgtgaa
aaaaaaatttttttaataattataaaatactttaaattaataaatatagaattaataaaa
attagaaaagttattaatttatatttatataataattattataattatatgtatatatct
catatcgatacagtaagcgaaagtaatgtaaaatggattttaaatccttttttaagttta
ttatttaaaaaaaaaataattaatagaggaattatcgatatgaaaggttcgtttattagt
gttttattttttaacaaaaaaattttaaattttattttaacaaatgatgaagaatcagtt
tctatttatggaatacaatatactttaaatatattaaatataagaaaaaaaaaaatttat
ttttttatgggtacagaaccaacttcagaaaatataataggagattatactaaaatttca
agaagaggttcttttaatttaaaaattatttttttaggaaaaaataaacattgtgcatat
attggtaaaaatttaataaagatgttgtttaaaaattttttttttttaaaaaatgatgtt
aaaaaatttaatattttagaatatacaaatattttttgtggaaataattctgataatttt
ttatctaataaattatttttaaaaattaattttagatttaattttttaagaaaaattatt
atcttaaagaaaaaatttttaaaatttttaatatcaaaaaatgtttatatagtatggaaa
cttagtggaattccatttttttgttataaaaatttttttttaaaaaatatttttaatata
atttattatattcaaaacataaaaactaaaataaattttttaggtggaacttcagattta
cgatattgtttttatatttatcaatattcagaaatatttgaattaggtttaattaataaa
tcaattcataaaataaatgaaaattgttttttagatgattgtttaattttatcaattata
ttttattattttatttatgggattaaatag

DBGET integrated database retrieval system