KEGG   Chromohalobacter salexigens: Csal_0063Help
Entry
Csal_0063         CDS       T00347                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
csa  Chromohalobacter salexigens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Csal_0063
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Csal_0063
Enzymes [BR:csa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Csal_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(82250..83281)
Genome map
AA seq 343 aa AA seqDB search
MSPHLLSVDSLSRDYVEHLMQLAGRMEPFAQRRKVTRVLEGAVLGNLFFEASTRTRISFH
AAFSRLGGSVCDTTGFTFSSMAKGESLYDTSRVMGGYVDAIVLRHPDQGAVAEFAEATRV
PVINGGDGPGEHPSQALLDLYTIEKEFTRLGKRLEGAHLLLTGDLKHGRTVHSLIKLLSL
FDPLRITLVSPPGLEMPRHLIDLVASRGHRVEQRESLANDFGDLDVIYTTRIQKERFTDE
MSETFAGISQDFIVDRAFLDKRCSPTTIVMHPLPRDSRPGANDLNVDLNGDPRLAIFRQA
DNGIPMRMAIFANLLRVEDYIERDAQDVRWFVPPTFGVDDRTL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagtccccacctgctttccgtcgattccctgtcccgcgattacgtcgaacacctgatg
cagctcgccggccgcatggagcccttcgcccagcggcgcaaggtgacccgcgtgctcgag
ggcgcggtgctcggcaacctgttcttcgaagccagcacacggacccgcatcagctttcac
gcggcgttctcgcgtctcggcggcagtgtctgcgacaccaccggcttcaccttctcgtcg
atggccaagggtgagtccctctacgacaccagccgcgtgatgggcggttacgtcgatgcc
atcgtcctgcgccaccccgaccaaggcgccgtggcggaattcgccgaggccacgcgagtg
ccggtgatcaacggcggcgacggccccggcgagcaccccagtcaggcgctgctggacctc
tacaccatcgagaaggaattcacgcgcctgggcaagcgtctcgaaggcgcgcacctgctg
ctgaccggcgatctcaagcatggccgtaccgtgcactcgctgatcaagcttttgtcgctg
ttcgacccgctgcgcatcacgctggtatcgcccccggggctggaaatgccgcgtcacttg
atcgatctggtcgcctcgcgaggacatcgcgtggagcagcgcgaaagcctggccaacgat
ttcggcgacctcgacgtgatctacaccacgcgtatccagaaggagcgcttcaccgacgag
atgtcggagaccttcgccggcatctcccaggacttcatcgtcgatcgcgccttcctcgac
aagcgctgctcgccgaccaccatcgtcatgcaccccctgccgcgcgacagccgtcccggc
gccaacgatctcaacgtcgacctcaatggcgacccgcgcctggccatcttccgccaggcc
gacaatggcattcccatgcgcatggcgatcttcgccaacctgctgcgcgtcgaggattac
atcgaacgcgacgcccaggacgtgcgctggttcgtgccgccgaccttcggcgtcgacgac
cgcacgttgtag

DBGET integrated database retrieval system