KEGG   Chromohalobacter salexigens: Csal_0477Help
Entry
Csal_0477         CDS       T00347                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00330  Arginine and proline metabolism
csa00332  Carbapenem biosynthesis
csa01100  Metabolic pathways
csa01130  Biosynthesis of antibiotics
csa01230  Biosynthesis of amino acids
Module
csa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Csal_0477
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Csal_0477
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Csal_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA YqfQ
Motif
Other DBs
NCBI-ProteinID: ABE57839
JGI: Csal0477
UniProt: Q1R0B9
Position
525380..526516
Genome map
AA seq 378 aa AA seqDB search
MSESQSASRDALRRARRVVVKIGSALLTNDGRGLDADAIGEWVDQIAALHARGIEVVLVS
SGAVAEGMARLGWVTRPSAVHELQAAAAVGQSGLSQCYEEHFARHGLRSAQVLLTHDDLS
NRKRYLNARSALRSLVALRVVPVINENDTVVTDEIRFGDNDTLGALVANLLEADALVLLT
DQEGLFDADPRHDPEARLIAEGRADDPALAAVAGDGGALGRGGMATKVRAARLAARSGAL
TAIASGRQPEVLTRLMQGETLGTLLMPDHAPLAARKRWLAGQLQVRGTLVLDAGAVKVLR
EHGSSLLPVGVRRVEGEFKRGDMLVCVDEQGQRIAKGLVNYGSDEARRIMGQPSRRIEEL
LGYMESPELIHRDNLVIV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaatcgcagtcggcaagccgcgatgccctgcgtcgggcgcggcgtgtcgtggtc
aagatcggaagtgcgttgctgaccaacgatgggcgcggcctcgatgccgatgccatcggc
gaatgggtcgatcagatcgccgccttgcatgcgcggggcatcgaggtcgtgctggtgtcg
tccggtgccgtggccgagggcatggcgcgcctggggtgggtgacgcgtccctcggcggtg
catgaattgcaggcggcggcggcggtagggcaatccggcctgtcgcagtgttacgaggaa
catttcgcgcggcatggcctgcgcagtgcgcaggtcctgttgacccacgacgacctttcc
aaccgcaagcgatatctcaatgcgcgttcggcgctgcgctcgctggtggcgctgcgcgtg
gtgccggtgatcaatgaaaacgacaccgtggtcaccgacgagattcgcttcggcgacaac
gatacgctgggcgcgctggtggccaatctgctcgaggcggatgccctcgtcctgctgacc
gatcaggaaggcttgttcgacgccgatcctcgtcacgaccccgaggcgcgcctgattgcc
gaggggcgtgccgatgacccggcgctggccgcggtcgccggtgacggcggtgccctgggg
cgtggcgggatggcgaccaaggtccgtgcggctcgtctggccgctcgctccggcgcgctg
acggcgatcgccagcgggcgtcagccggaggtgctcacgcggctgatgcaaggcgagacg
ctgggcacgctgttgatgcccgatcacgctcccctggcggcccgcaagcggtggctggcc
gggcagcttcaggtgcgcggcaccctggtgctggatgccggcgcggtcaaggtgctgcgc
gagcatggctccagcttgctgccggtgggcgtgcgtcgtgtcgagggcgagttcaagcgc
ggcgacatgctggtctgcgtggacgagcagggccagcgcatcgccaaggggctggtcaat
tacggcagcgacgaagcgcggcgcatcatggggcagcccagccggcgcatcgaggagctg
ctggggtacatggagtcgccggaactcattcatcgcgacaacctggtcatcgtgtga

DBGET integrated database retrieval system