KEGG   Chromohalobacter salexigens: Csal_0497Help
Entry
Csal_0497         CDS       T00347                                 

Definition
ribosomal large subunit pseudouridine synthase D
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
csa  Chromohalobacter salexigens
Brite
Enzymes [BR:csa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Csal_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
544997..545974
Genome map
AA seq 325 aa AA seqDB search
MEPSIAMADTVQREERVPDTMIGLRLDQAAAELFADFSRERLKAWIKSGALTRDGAPARP
KDKLFGGERLTLEATLEEDTRFAPQAMALSIVHEDDDVLVIDKPAGLVVHPAAGNPDGTL
LNALLHHAPGQMQLPRAGIVHRLDKDTTGLMVVAKTLAAHASLVEQLQARTVSREYDAVV
TGRMTAGGSVDAPIGRHPKDRKRQAVTPSGKPAVTHYRVVERFPAHTHVRCRLETGRTHQ
IRVHMAHRRFPLIGDPVYAGRLKMPAGATDALKDVLRHFPRQALHARKLAFVHPGTGETL
TFRAPLPDDMLMLLDFLRDAADTPT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgagcattgccatggcagataccgtgcagcgagaagaacgcgtccccgacacc
atgatcggcctgcgcctggatcaagccgccgccgagctgttcgcggacttctcccgcgag
cgtctcaaggcctggatcaagtcgggcgcattgacccgggacggcgcgcctgcgcggccc
aaggacaagctgttcggtggcgagcggctgacgctcgaggccacgctcgaggaagacacg
cgcttcgcaccgcaggccatggcgctgtcgatcgtccacgaagacgacgatgttctggtc
atcgacaagcccgcggggctggtcgtgcatccggccgccggcaatcccgatggcaccttg
ctcaatgccttgctgcaccatgcgccgggacagatgcaactgccccgtgccgggatcgtg
catcgtctcgacaaggacaccaccggcctgatggtggttgccaagacgctggctgcgcat
gcctcgctggtcgagcagttgcaggcacgtacggtatcgcgtgagtacgatgccgtggtg
accggcaggatgacggccggtggcagtgtcgatgcaccgatcggccgccatcccaaggat
cgcaagcgccaggcggtcaccccgtcgggcaagccggcggtgacgcattaccgcgtggtg
gagcgctttcccgctcacacccatgtgcgctgccggctcgaaaccgggcgcacccaccag
attcgcgtgcatatggcgcatcggcgctttccgctgatcggcgatccggtctatgccggg
cgcctcaagatgccggccggcgccaccgacgcactgaaggacgtgctgcgtcattttccg
cgtcaggcgctgcatgctcgcaaactggccttcgtgcatcccggcacgggcgagacgctg
acgtttcgcgcgcccttgcccgacgatatgctgatgttgctggatttcctgcgcgatgca
gccgacacgccgacctga

DBGET integrated database retrieval system