KEGG   Chromohalobacter salexigens: Csal_0569Help
Entry
Csal_0569         CDS       T00347                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00900  Terpenoid backbone biosynthesis
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Csal_0569
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Csal_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Sacchrp_dh_NADP Epimerase NmrA
Motif
Other DBs
NCBI-ProteinID: ABE57931
JGI: Csal0569
UniProt: Q1R027
Position
630408..631580
Genome map
AA seq 390 aa AA seqDB search
MTVLGATGSIGRSTLDVIGRHPERYRLHALTAHRSRETLRDQCLAHRPDIAVLGTEDDAA
WLRAALSDAGLDTEVRAGEAALAEVAGSRDSDVVMAAIMGAAGLMPTLAAVRAGKRVLLA
NKEALVMSGALFMDAVDRHGAVLLPIDSEHNAIYQCLPTEHRGGLTRHGVTQLLLTASGG
PFRGWSQAQLDEVTPEQACAHPNWSMGRKISVDSATLMNKGLELIEACWLFDARPEQIQV
VVHPQSVIHSMAAYSDGSVIAQMGNPDMRTPIAHGLAWPERIDAGVAPLDLFAVARLDFE
APDESRFPCLRLAREAMAAGGTAPATLNAANEVAVAAFLEGRLKFAQIPALVAVVCEACE
VQSAHTLEAVLAADATARRVAERELSRFTS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgctcggggccaccggctccatcggtcgcagcaccctcgatgtcattggccgt
caccccgaacgctatcggttgcatgccctgaccgcccaccgctcccgtgagacgcttcgc
gatcagtgtcttgcgcaccgccccgacatcgcggtcctcggcacggaagatgatgccgcc
tggctgcgtgccgcactgagcgacgccggcctcgacaccgaggtgcgcgccggcgaggcg
gcgctcgccgaggtcgcgggaagtcgcgacagcgacgtggtcatggccgcgatcatgggg
gccgccggcttgatgccgacgcttgcggcggtacgcgccggcaagcgcgtcctgctggcc
aacaaggaagccctggtgatgtccggcgcgttgttcatggacgccgtcgaccggcatggc
gcggtacttttgcccatcgattctgaacataatgccatctaccagtgtctacccacggag
catcgtggcggactgacgcgccatggcgtgacccagttgttgctgacggcgtcgggcggg
ccgttccgaggctggtcgcaagcccagctggacgaggtgacgcccgaacaggcttgtgcg
caccccaactggtcgatgggccgcaagatctcggtggacagcgcgaccttgatgaacaag
gggctcgagttgatcgaggcctgctggttgttcgatgcgcgtcccgaacagatccaggtg
gtggtgcatccgcagagcgtgattcactcgatggcggcgtacagcgatgggtcggtgatc
gcccagatgggcaatcccgacatgcgcactccgatcgcccacggactggcgtggcccgag
cgcatcgacgccggcgtcgcgccgctggacctgttcgccgtggcgaggctcgatttcgag
gcccccgacgagtcgcgtttcccgtgcctgcgtctcgcccgcgaggcgatggcggcgggc
ggtacggcgccggccaccttgaacgccgccaacgaagtggccgtggcggcgtttctcgag
gggcggttgaagtttgcgcagatccccgcgctggtggcggtggtatgcgaggcatgcgag
gtgcagtcggctcacacgctggaggcggtgctggcggctgacgccaccgcgcggcgtgtc
gccgagcgcgaattgagccggttcacgtcatga

DBGET integrated database retrieval system