KEGG   Chromohalobacter salexigens: Csal_0856Help
Entry
Csal_0856         CDS       T00347                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00010  Glycolysis / Gluconeogenesis
csa00020  Citrate cycle (TCA cycle)
csa00620  Pyruvate metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01130  Biosynthesis of antibiotics
csa01200  Carbon metabolism
Module
csa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_0856
   00020 Citrate cycle (TCA cycle)
    Csal_0856
   00620 Pyruvate metabolism
    Csal_0856
Enzymes [BR:csa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Csal_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_3 Peptidase_M23 TRAM CAT HC2
Motif
Other DBs
NCBI-ProteinID: ABE58213
JGI: Csal0856
UniProt: Q1QZ95
Position
958102..960189
Genome map
AA seq 695 aa AA seqDB search
MSSEIIKVPDIGGSEGVEIIEVTVSEGDVIAPEDTMITLESDKASMDVPAPKGGKVVKVL
VKEGDTVSEGDDILELEAEGGGDDAGDTASQDEEASQDASASEEQEMAAPEKAAPKKSGG
GGKRTVEVKVPDIGGSEGVEIIEVPVSEGDEIEAEDTLITLESDKASMDVPSPYSGKLVS
LAVKEGDSVSEGDVIGSMEIAGEGGDDDETDAAPAEDDASSALAEDEADGDDSEEDAGEG
ESGRKELRVPDIGGSEGVEIIEVAIGEGDEIGEEDTLITLESDKASMDVPSPYKGKVVEV
SVKEGDSVSEGDLIGYIEVAGTPVAGAKKPAKKSDGGKKSGAEKADAGQQKATDSRPAPA
KSDAKRAAQPAGEPSPEARHKHGDKKTAGAHVHAGPAVRMLARELGVDLAQVTPTGPKSR
VLKEDVQGYVKNALQQRASGTGSTAAPTDGAGIPAVPDIDFSQFGEVEEKPMGRLMKAGA
ANLHRSWLNVPHVTQFDEADITELEAFRKSMKDEAAKQDAKLTPLPFLIKACAYALQKFP
QFNVSLKSDGETLVQKHYVHIGIAVDTPDGLMVPVIRNADQKSLIELAKESVELAGKAQS
KKLKREEMTGGCFTISSLGSIGGTAFTPIVNAPEVAILGVSKAQMKPVWDGAEFAPRLMM
PLSLSYDHRAVNGADAARFTAFLAQALSDIRRLLM
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagcgaaatcatcaaagttcccgatatcggcggcagcgaaggcgtcgagatcatc
gaggtgacggtgtccgagggcgatgtcatcgcgcccgaggacaccatgatcacgctggaa
tccgacaaggccagcatggacgtccccgcgcccaagggcggtaaggtcgtcaaggtgctg
gtcaaggaaggcgataccgtctccgagggcgacgacatcctcgagctcgaagcggaaggc
ggtggcgacgacgccggtgataccgcctctcaggacgaggaagcgtcacaggacgcgagt
gcctccgaagagcaggaaatggcggcacccgaaaaggcggcgccgaagaagtccggcggt
ggcggcaagcgtaccgtcgaggtcaaggtgccggatatcggcggcagtgaaggcgtcgag
atcatcgaggtaccggtcagcgaaggcgacgagatcgaggcggaagacaccttgatcacg
ctggagtccgacaaggcgtccatggacgtcccgagcccgtacagtggcaagctggtctcg
ctggcggtcaaggaaggcgacagtgtttccgaaggcgatgtgatcggcagcatggagatc
gccggcgaaggcggggacgacgacgagaccgacgcggcaccggcggaagacgacgcgagc
agcgccctggcggaagacgaggccgacggcgatgacagcgaagaggacgcaggcgaaggc
gagtccggccgcaaggaacttcgcgtccccgatatcggcggcagcgaaggcgtcgagatc
atcgaggttgccatcggcgaaggtgacgagatcggcgaggaagatacgctgatcacgctg
gagtccgacaaggcctccatggacgttcccagcccctacaagggcaaggtggtcgaagtc
tcggtcaaggaaggcgacagcgtttccgagggcgacctgatcggctacatcgaggtggcc
ggcactccggtggccggcgcgaagaagccggccaagaagtccgatggcggcaagaagtcc
ggcgccgagaaagccgacgccggtcagcaaaaggcgactgactcccggccggcgccggcc
aagtccgatgccaaacgcgctgcgcagcctgcaggcgagccgagtcccgaggcacgtcac
aagcacggcgacaagaagactgccggtgcgcacgtgcatgccgggccggcggtccgcatg
ctggcgcgtgaactgggcgtcgacctggctcaggtcacgcccaccgggcccaagagtcgc
gtactgaaggaagacgtccagggttacgtcaagaacgcccttcagcagcgcgccagcggc
accggaagcacggccgcgccgacggacggtgcgggcatcccggcggtgccggacatcgac
ttcagccagttcggcgaggtcgaggaaaagcccatgggccgcctgatgaaggccggtgcg
gccaacctgcatcgcagctggctcaacgtgccgcacgtgacccagttcgacgaagcggac
atcaccgagctcgaggccttccgcaagtcgatgaaggacgaggctgccaagcaggacgcc
aagctcacgccgctgccgttcctgatcaaggcctgcgcctatgccttgcagaaattcccg
cagttcaacgtcagcctgaagagcgacggcgagaccctggtgcagaagcattacgtgcac
atcggtatcgccgtggatacgccggacggcctgatggtgccggtgatccgcaacgccgat
cagaagtcgctgatcgagctggccaaggaatcggtcgaactggccggcaaggcacagtcg
aagaagctcaagcgcgaggagatgacgggcggctgcttcaccatctccagcctgggttcc
atcggtgggactgccttcacgcccatcgtcaacgccccggaagtcgccatcctcggcgtc
tccaaggcgcagatgaagccggtgtgggacggtgcggagttcgccccaaggctgatgatg
ccgctgtcgctgtcctacgatcaccgcgcggtcaacggtgcggatgcggcgcgcttcacg
gccttcctggcccaggcgctgagcgatattcgtcgcctgttgatgtaa

DBGET integrated database retrieval system