KEGG   Chromohalobacter salexigens: Csal_0935Help
Entry
Csal_0935         CDS       T00347                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00010  Glycolysis / Gluconeogenesis
csa00052  Galactose metabolism
csa00500  Starch and sucrose metabolism
csa00520  Amino sugar and nucleotide sugar metabolism
csa00521  Streptomycin biosynthesis
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01130  Biosynthesis of antibiotics
csa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_0935
   00052 Galactose metabolism
    Csal_0935
   00500 Starch and sucrose metabolism
    Csal_0935
   00520 Amino sugar and nucleotide sugar metabolism
    Csal_0935
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Csal_0935
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Csal_0935
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Csal_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABE58292
JGI: Csal0935
UniProt: Q1QZ16
Position
complement(1048841..1049800)
Genome map
AA seq 319 aa AA seqDB search
MTRPALIGDIGGTNARFALVTPGAFDLHDIRTLPCAHYPSLSDAIRAYLKEVGAEMPTEA
CLAFACPVHDDEVRMTNNAWRFSKRQVAEEFGFTLFKVINDFTAQALGVPHVADDELVAL
GDGEAAPGCTRLIFGPGTGLGMAGLFPGQHDWIPLPTEGGHISFAPTDQHERDLLAYFQA
RYGRVSVERILCGQGLLDLYRAHAQLAKQVARYNTPAEVTGAARAGDPLARNALERFLKI
LGDVSGDAALMLGARGGVYLCGGILPRLLDWLPHSHFRDAFADKGRMHAYTAHIPVWVVT
APWNGLLGACEALHNEEVT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaccggcactgatcggcgatatcggcggcaccaatgcgcgcttcgccctggtg
acgccgggggcgttcgaccttcatgacatcagaaccctgccctgcgcgcattatccttcg
ctgtccgacgcgattcgcgcctacctcaaggaggtgggcgccgagatgccgacggaagcc
tgcctcgccttcgcctgccccgtgcacgacgacgaggtccgcatgaccaacaatgcctgg
cgcttctccaaacgccaggtcgccgaggaattcggcttcaccctgttcaaggtcatcaac
gacttcaccgcccaggccctgggcgtgccccacgtggcggacgacgaactcgtcgcgctc
ggggacggcgaggccgcgccggggtgcacgcgcttgatcttcggccccggcacgggcctt
ggcatggcggggctctttcccggtcagcatgactggattccgctgcctaccgaaggcggc
catatctccttcgcccccaccgatcaacacgaacgtgacctgctggcctattttcaggca
cgctacgggcgcgtctcggtggagcgcattctctgcggccaggggcttctggacctgtac
cgcgcgcatgctcaactggccaagcaggtcgcgcgctacaacaccccggcggaggtcacc
ggcgcggcccgggccggcgatcccctggcacgcaacgccctcgagcgattcctcaagatt
ctcggcgacgtcagtggcgacgctgccctgatgctcggcgcgcgcggcggggtctatctg
tgcggtggcattctgccgcgactgctcgactggctgccgcacagccacttccgcgatgct
ttcgccgacaaagggcgcatgcacgcgtacactgcccacattcccgtgtgggtggtcacg
gcaccctggaatgggctgctgggcgcctgcgaagcattacacaacgaggaggtgacatga

DBGET integrated database retrieval system