KEGG   Chromohalobacter salexigens: Csal_0935Help
Entry
Csal_0935         CDS       T00347                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csal_0935
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_0935
   00052 Galactose metabolism
    Csal_0935
   00500 Starch and sucrose metabolism
    Csal_0935
   00520 Amino sugar and nucleotide sugar metabolism
    Csal_0935
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Csal_0935
   00524 Butirosin and neomycin biosynthesis
    Csal_0935
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Csal_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1048841..1049800)
Genome map
AA seq 319 aa AA seqDB search
MTRPALIGDIGGTNARFALVTPGAFDLHDIRTLPCAHYPSLSDAIRAYLKEVGAEMPTEA
CLAFACPVHDDEVRMTNNAWRFSKRQVAEEFGFTLFKVINDFTAQALGVPHVADDELVAL
GDGEAAPGCTRLIFGPGTGLGMAGLFPGQHDWIPLPTEGGHISFAPTDQHERDLLAYFQA
RYGRVSVERILCGQGLLDLYRAHAQLAKQVARYNTPAEVTGAARAGDPLARNALERFLKI
LGDVSGDAALMLGARGGVYLCGGILPRLLDWLPHSHFRDAFADKGRMHAYTAHIPVWVVT
APWNGLLGACEALHNEEVT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaccggcactgatcggcgatatcggcggcaccaatgcgcgcttcgccctggtg
acgccgggggcgttcgaccttcatgacatcagaaccctgccctgcgcgcattatccttcg
ctgtccgacgcgattcgcgcctacctcaaggaggtgggcgccgagatgccgacggaagcc
tgcctcgccttcgcctgccccgtgcacgacgacgaggtccgcatgaccaacaatgcctgg
cgcttctccaaacgccaggtcgccgaggaattcggcttcaccctgttcaaggtcatcaac
gacttcaccgcccaggccctgggcgtgccccacgtggcggacgacgaactcgtcgcgctc
ggggacggcgaggccgcgccggggtgcacgcgcttgatcttcggccccggcacgggcctt
ggcatggcggggctctttcccggtcagcatgactggattccgctgcctaccgaaggcggc
catatctccttcgcccccaccgatcaacacgaacgtgacctgctggcctattttcaggca
cgctacgggcgcgtctcggtggagcgcattctctgcggccaggggcttctggacctgtac
cgcgcgcatgctcaactggccaagcaggtcgcgcgctacaacaccccggcggaggtcacc
ggcgcggcccgggccggcgatcccctggcacgcaacgccctcgagcgattcctcaagatt
ctcggcgacgtcagtggcgacgctgccctgatgctcggcgcgcgcggcggggtctatctg
tgcggtggcattctgccgcgactgctcgactggctgccgcacagccacttccgcgatgct
ttcgccgacaaagggcgcatgcacgcgtacactgcccacattcccgtgtgggtggtcacg
gcaccctggaatgggctgctgggcgcctgcgaagcattacacaacgaggaggtgacatga

DBGET integrated database retrieval system