KEGG   Chromohalobacter salexigens: Csal_1091Help
Entry
Csal_1091         CDS       T00347                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
csa  Chromohalobacter salexigens
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Csal_1091
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Csal_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1233857..1234885
Genome map
AA seq 342 aa AA seqDB search
MKALVYEGVGQKAWKEKDRPAIEQTTDAIVRVTYTTICGTDLHILKGDVPAVTPGRTLGH
EGIGVIKEVGGAVSGLAVGDQVLISCITSCGHCDYCKQGMYAHCRDGGWILGHKIDGTQA
EVVRIPHAANSLYRLPPGLEPAAALMLSDILPTGHEIGALNGEVSLGDTVAIVGSGPIGL
AALLTARFYSPGRIIMVDPDENRLAVARQLGATDTVSTDPVETVMSLTDGEGVDVAMEAV
GIPETFDTCQRILRPGGRLANIGVHGRSVELRLEELWIKNVTVRTGLVNTNTIPVLMRFL
ETGGIDAESLITHRFALDEIEKAYEVFSRAASEKAIKMLLTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttgtctatgagggagtggggcagaaggcctggaaagagaaggatcggccc
gcaatcgagcaaaccacggatgccatcgtgcgggtgacgtataccaccatttgcggcacc
gacctgcacatcctcaagggcgatgtgccggcggtgacgccggggcgcaccctgggccat
gaaggcatcggggtgatcaaggaagttggcggggccgtcagcggcctcgcggtcggcgat
caggtgctgatctcgtgcatcacgtcgtgcgggcactgcgattactgcaagcagggcatg
tatgcgcattgccgcgatggcgggtggattctcggtcacaagatcgatggcacccaggcc
gaggtggtgcgcattccgcatgccgccaacagcctgtaccggttgccgccggggctggag
cccgccgcggcgctgatgctgagtgacatcctgcccaccggccacgagatcggcgcgttg
aacggagaggtctcgctgggggataccgtggccatcgtcggctcgggccccatcgggctg
gccgccttgttgaccgcgcgcttctattcgccggggcgcatcatcatggtcgacccggac
gagaatcgcctggccgtggcgcggcaactgggcgcgaccgacaccgtcagtaccgatccg
gtggagacggtcatgtcgcttaccgacggcgagggcgtcgacgtggccatggaggccgtg
ggtatccccgagacgttcgatacctgccagcgcatcctgcgtccgggcgggcggctcgcc
aacatcggcgtgcatggccgcagcgtcgaactgcgcctcgaggagctgtggatcaagaac
gtcacggtccgcaccgggctggtgaataccaataccattcccgtgctcatgcggtttctc
gagaccggcggcatcgatgccgaaagcctgatcacccaccgcttcgcgctggacgagatc
gaaaaggcgtacgaggtgttctcgcgtgccgcgtcggaaaaggccatcaagatgctgctg
accgcctga

DBGET integrated database retrieval system