KEGG   Chromohalobacter salexigens: Csal_1218Help
Entry
Csal_1218         CDS       T00347                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
csa  Chromohalobacter salexigens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csal_1218
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Csal_1218
  Amino acid metabolism
   00310 Lysine degradation
    Csal_1218
Enzymes [BR:csa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Csal_1218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1395024..1396607
Genome map
AA seq 527 aa AA seqDB search
MATEIKAPNFPESVAEGTIATWHKKVGDSVERDELIVEIETDKVVLEVVAPEAGTVTEIK
VEEGDTCDSEQVLGMLGAASEGSNDKAASQESAEKSDDSGQDTAPAKADAKPAASGKQHD
VKAPSFPESVQEGTVATWHKQVGEAVKRDEILADIETDKVVLEVVAPADGALSEIKVQEG
EQVESEAVLAVFAEGAGGEASGGDAAASKDASEPAAADGGSDEKVGDKILAPAARKLVAE
HDLDVNKIEGTGKGGRILKEDVQKAVKDGSAKKSAKPSGGDVKAAAAPAPAVEGERPEQR
VPMSRLRQTIAKRLVQAQQTAAMLTTYNEVDMSAVMALRSQYKDSFQKAHDVKLGFMGFF
VKAATEALKRFPDVNASIDGTDIVYHGYQDIGVAVSTPRGLVVPVLRDTDSMKLADVEKT
IGDFGQRGREGKLGIEDMQGGTFTITNGGIFGSLMSTPILNPPQTAILGMHKIQERPMAV
NGKVEIRPMMYLAVSYDHRMIDGKDAVQFLVTIKELLEDPARFLLDV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgagatcaaagcgccaaattttccagaatccgtcgccgagggcaccatcgcc
acttggcacaagaaggtcggtgacagcgtcgaacgtgatgaactgatcgtcgagatcgag
acggacaaggtcgtcctcgaggtcgtcgccccggaagccggtaccgtgaccgagatcaag
gtcgaggaaggcgacacttgcgactccgagcaggttctggggatgctgggcgcggccagc
gaaggcagcaacgacaaggccgcctctcaggaaagcgcggaaaagagcgacgacagcggc
caggacactgcaccggccaaggccgatgccaagcctgccgcctccggcaagcagcatgac
gtgaaggcgccgagcttccctgagtccgtgcaggaaggcaccgtcgccacctggcacaag
caggtcggcgaagcggtgaagcgtgacgagattctcgcggatatcgagaccgacaaggtc
gtgctcgaagtggtggcgccggccgatggtgccctcagcgagatcaaggtgcaggaaggt
gagcaggtcgagtccgaagccgtgctcgcggtctttgccgaaggcgccggcggcgaggcg
agcggcggtgacgccgccgcttcgaaggatgcgagcgaacccgctgcggcagacggcggc
agcgacgaaaaggtcggcgacaagatcctggcgcccgcggcacgcaagctggtggccgag
catgatctggacgtcaacaagatcgaaggcactggcaagggcggtcgcatcctgaaagag
gacgtgcagaaagccgtcaaggacggctccgccaagaagagcgccaagccgtcaggcggt
gacgtcaaggccgctgctgcgccggcgccggccgtcgagggcgagcgccccgagcagcgt
gtgccgatgagccgtctgcgccagaccattgccaagcgcctggtccaggcacagcaaacg
gccgccatgctcaccacctacaatgaggtggacatgagcgcggtgatggcgctgcgcagt
cagtacaaggacagcttccagaaggcgcacgacgtcaagctcggcttcatgggcttcttc
gtcaaggcggcgaccgaggcgctcaagcgcttcccggacgtcaacgcttccatcgacggc
accgacattgtctaccacggctaccaggacatcggtgtcgccgtttccacgccgcgtggt
ctggtggtaccggtgcttcgcgataccgacagcatgaagctggccgatgtcgagaaaacg
atcggtgacttcggccagcgtggccgtgaaggcaagctcggcatcgaagacatgcagggc
gggaccttcaccatcaccaatggcggtatcttcggctcgctgatgtcgacgccgatcctg
aacccgccgcagaccgcgattctggggatgcacaagattcaggaacgcccgatggccgtg
aacgggaaggtcgagatccgtccgatgatgtatctcgccgtctcctacgaccaccgcatg
atcgacggcaaggatgcggtacagttcctggtcacgatcaaggaattgctggaagatccc
gcgcgcttcttgctcgacgtgtga

DBGET integrated database retrieval system