KEGG   Chromohalobacter salexigens: Csal_1249Help
Entry
Csal_1249         CDS       T00347                                 

Definition
(GenBank) L-proline dehydrogenase / delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00250  Alanine, aspartate and glutamate metabolism
csa00330  Arginine and proline metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Csal_1249
   00330 Arginine and proline metabolism
    Csal_1249
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Csal_1249
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Csal_1249
Transcription factors [BR:csa03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Csal_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: ABE58604
JGI: Csal1249
UniProt: Q1QY54
Position
complement(1425819..1429010)
Genome map
AA seq 1063 aa AA seqDB search
MLNANTMLENATWNDELDTLFARVSDHYSVDENAYVAELAAVLRSDDEDFKRIAAQTAEL
VRDVRDMDTAVDSIDELLQEYSLDTHEGLMLMCLAEAMLRIPDKATADALIEDKLGPADW
KAHVGQSESWFVNASTWGLLMTGRVLQLDHPREGKPANFINKMVNRMGEPVIRRAMYQAM
KIMGKQFVLGRTIDEALKRSQPLFDKGYTYSYDMLGEAARTRPDAGRYYDDYANAIARVG
ATSRKLDAKTPSPSVSIKLSALHPRYEFGRRSQVLDELVDSVRQLVTLARENEVAITIDA
EEADRLELSLEVFRAVFESDVCRGWGHFGLVVQAYSKRALPVLHYLNRLADQCGDEIPLR
LVKGAYWDTEIKEAQQQGLDGYPVFTRKAGTDVAYLACVHFLLSEETRGRIFPQFATHNA
HTISTILELANDAGRHFEFQRLHGMGEALYEVALKRAPQGTYCRIYAPVGAHKDLLPYLV
RRLLENGANSSFVHQLVDPRVPVESLCVHPLETLSQYETYANSRIPLPRDIYGEKRKNSK
GVNLNINSQYQPLIDAMASFMETEYHAKPLLAFTVEDDAAQCHDVLSPYDTRQRVGDVQW
TTSEQARRAVDAAWAAFPRWTDTPVEERAAILERFADLLETHLAELMTLCSREGGKLLTD
GVDEIREAVDFCRYYAMRAREMFDAPIPLPGPTGESNELILSGKGVFAAISPWNFPVAIF
CGQMVAAAVAGNPVLAKPAEQTSLIAHRVVELLHEAGMPRDVVQLLPGDGPTVGSVLTGD
ARITGVVFTGGTDTAQIINRALADREGAALPTLIAETGGMNAMIVDSTALPEQVVVDVVG
SAFQSAGQRCSALRVLYLQEDIADRVIEILKGAMAELHIGDPRELGTDVGPVIDEDAHRQ
LSDYIARLKEEGRLVAEATPDPDVIAHGHFIAPTAFEVEGIEALEREQFGPILHIARYRS
ADIDQVIDTINAKGYGLTFGVHSRNESFAAEIARKIRVGNVYVNRNIIGAVVGVQPFGGQ
GLSGTGPKAGGPHYLQRFATEKTRTINTAALGGNASLLALGDE
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgccaataccatgctggaaaacgccacctggaacgatgagctcgacacgctc
tttgcacgtgtcagcgatcattacagtgtcgacgagaatgcctatgtcgccgaactggcc
gcggtgctgcgcagcgacgacgaggatttcaaacgcatcgccgcgcagaccgccgaactg
gtacgcgacgtccgcgacatggatacggcagtcgactccatcgacgagctgcttcaggaa
tacagcctcgatacccatgaaggcttgatgctgatgtgtctggccgaggcgatgctgcgc
atccccgacaaggccaccgcggacgccttgatcgaagacaagctgggccccgccgactgg
aaggcacacgtcggccagagcgagtcctggttcgtcaatgcgtccacctgggggctgctg
atgaccggccgtgtccttcagctcgatcatccgcgcgagggcaagcccgccaacttcatc
aacaagatggtcaaccgcatgggcgagccggtgattcgtcgcgccatgtaccaggcgatg
aagatcatgggcaagcagttcgtgctcggacgtaccatcgacgaggccctgaagcgctcg
cagccgctgttcgacaaggggtacacctactcctacgacatgctcggcgaagccgcgcgc
acgcgccccgacgccgggcgctattacgacgattacgccaatgccatcgcgcgggtcggc
gccaccagccgcaagctggacgccaagacaccgtcgccctcggtctcgatcaagctctcg
gcgctgcacccgcgctacgagttcggccgccgcagccaggtgctcgacgagctcgtcgac
agcgtccgccagctcgtcaccctggcccgcgagaatgaggtcgccattaccatcgatgcc
gaggaggccgatcgcctcgagttgtcactcgaggtattccgcgccgtcttcgaaagcgat
gtatgtcgtggctggggccacttcggcctggtcgtgcaagcgtattcgaaacgcgctctg
ccggtgctgcattacctcaatcgtctggccgatcaatgcggcgacgagatcccgctgcgc
ctggtcaagggcgcctactgggataccgagatcaaggaggcccagcagcaagggctcgac
ggctatccggtgttcacgcgcaaggcggggaccgatgtcgcctatctcgcatgcgtgcac
tttcttctctcggaggagacccgcgggcgcatcttcccgcagttcgccacgcacaacgcc
cataccatcagcaccatcctggagctcgccaacgatgcgggtcggcatttcgagttccag
cgtctgcacggcatgggcgaggcgctctatgaagtcgccctcaagcgcgccccccagggc
acctactgccgtatctacgcgccggtcggcgcacacaaggacctgctgccctacctcgtc
cggcgcctgctggaaaacggtgccaactcgtccttcgtccaccagctggtcgatccccgc
gtgccggtggaaagtctctgcgtccatccgctggagaccctgtcgcaatacgaaacctat
gccaactcccggattccgttgccgcgcgacatctacggggaaaaacgcaagaattccaag
ggtgtcaacttgaacatcaacagtcagtatcagcccctgatcgatgccatggcatccttc
atggagaccgaataccacgccaagccattgctcgccttcacggtggaagacgacgccgcg
cagtgccacgacgtgctcagcccctacgacacgcgtcagcgcgtgggtgacgtgcagtgg
accaccagcgagcaggcgcgccgcgccgtggatgccgcctgggcagcgttcccccgctgg
accgacacgccggtcgaggagcgcgcggcgatcctcgagcgcttcgccgaccttctggaa
acgcacctcgccgagttgatgacactgtgctcgcgcgagggcggcaagctgctgaccgat
ggcgtcgacgaaatccgcgaagccgtggacttctgccgctattacgccatgcgcgcccgg
gagatgttcgacgcaccgatccccctgcccggccccaccggtgaatccaacgagctgatt
ctctccggcaagggggtgttcgccgccatcagcccgtggaatttcccggtggcgattttc
tgcggccagatggtcgctgccgccgtggccggcaacccggtgctggccaagcccgccgag
cagacctcgttgatcgcccatcgcgtcgtggagctgctccatgaagccggcatgcctcgc
gatgtggtgcaattgctgcctggcgacggccccaccgtgggcagcgtgctgaccggcgac
gctcgaatcaccggcgtggtctttaccggcggcaccgataccgcgcagatcatcaatcgc
gctctcgccgatcgcgaaggcgccgcgttgccgaccctgatcgccgagaccggcggcatg
aacgccatgatcgtcgactccaccgcgcttcccgaacaggtcgtcgtcgatgtggtgggc
tcggcgttccagagcgccggccagcgctgcagtgccttgcgcgtcttgtaccttcaggag
gatatcgccgacagggtcatcgagatcctcaagggtgccatggcggaactgcacatcggc
gacccacgcgagctgggcacggatgtcggcccggtaatcgacgaggacgcccaccgccag
ctcagcgactatatcgcacgcctcaaggaggaaggccgcctggtcgccgaggcaacgccc
gatcccgatgtcatcgctcacggtcacttcatcgcacccactgcattcgaggtcgaaggc
atcgaggcactggagcgcgagcaattcgggccgatattgcatattgcccggtatcgcagc
gcggatatcgatcaggtcatcgataccatcaacgccaagggctatggcctgacgttcggc
gtgcatagccgcaacgaatcctttgccgctgaaatagcgcgaaaaattcgtgtgggcaat
gtctacgtcaatcgtaatatcatcggcgctgtcgtgggcgttcaaccgttcggtggccaa
ggactctcgggaacggggccgaaggcgggcggaccgcactatctacaacgctttgccacg
gaaaagacccgtaccatcaacaccgccgcccttggcggcaatgcgtctctgctcgcgctg
ggagacgagtga

DBGET integrated database retrieval system