KEGG   Chromohalobacter salexigens: Csal_1261Help
Entry
Csal_1261         CDS       T00347                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Csal_1261
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Csal_1261
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Csal_1261
Enzymes [BR:csa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Csal_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1439442..1440656
Genome map
AA seq 404 aa AA seqDB search
MTKFSDLTRMPDAQGHFGPHGGRFVSETLSFALEELEKAYMSLRDDADFQAEFDRDLAHY
VGRPSPLYHAQRWSQQLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKKSGKPRVIAETG
AGQHGVATATVAARLGLKCEIYMGAEDVERQKLNVYRMRLLGAEVHPVESGSRTLKDAMN
EALRDWVTNVDDTFYIIGTVAGPHPYPAMVRDFTSVIGREAREQSFAQIGRLPDALVACV
GGGSNAIGLFYPFLEDEDVAMYGVEAGGDGVETGRHAAPLTANAPSGVLHGNRTYLMSDE
GGQVSDTHSISAGLDYPGVGPEHALWKDVGRVQYVAANDDAVLAAFRELTRVEGIMPALE
SAHALAHAKVLAPTMRPDQHIIVNLSGRGDKDIHTVAKIDGLEF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagttcagcgacctgacccgaatgccggacgcccaaggccatttcggcccgcac
ggtggccggttcgtttcggagactctgagcttcgccctggaggagttggagaaggcctac
atgagccttcgcgacgatgccgacttccaggccgaattcgaccgtgacctggctcattac
gtgggccgcccgtctccgctgtatcacgcacagcgatggtcccagcagctcggcggtgcg
cagatctggctcaagcgcgaggatctcaaccacaccggggcccacaaggtgaacaacacc
atcggccaggcgctgctcgccaagaagagcggcaagcctcgggtcatcgccgaaaccggt
gccggccagcatggcgtggccacggccaccgtcgccgcgcggctggggctcaagtgcgag
atctacatgggggccgaggacgtcgagcgccagaagctcaacgtctatcgcatgcgcctg
ctgggggccgaagtgcatccggtcgagtccgggtcgcgaaccctcaaggacgccatgaac
gaggcgctgcgcgactgggtgaccaatgtcgacgataccttctacatcatcggtaccgtg
gccggcccgcatccttatccggccatggtgcgcgacttcacgtcggtgatcggtcgcgaa
gcgcgcgagcagagctttgctcagatcggtcgcctgccggatgccctggtggcctgtgtc
ggcggcggttccaatgccatcggcctgttctatcccttcctcgaggacgaggacgtggcc
atgtacggtgtcgaagccggcggcgacggtgtcgagaccgggcgtcacgccgcgccgctg
accgccaatgcccccagcggggtgctgcatggcaaccggacctacctgatgtccgacgag
ggggggcaggtctcggatacgcactcgatctctgccgggctcgactatcctggtgtcggc
cccgagcatgcgctgtggaaggatgtcggccgggttcagtacgtggcggccaacgacgac
gcggttcttgccgcgttccgcgagctgacgcgcgtcgagggtattatgcccgcgctggag
tcggcccatgccctggcgcatgccaaggttctggcaccgaccatgcgtcccgaccagcac
atcatcgtcaatctctccgggcgtggcgacaaggacatccacacggtggccaagatcgac
ggtctggaattctaa

DBGET integrated database retrieval system