KEGG   Chromohalobacter salexigens: Csal_1262Help
Entry
Csal_1262         CDS       T00347                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Csal_1262
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Csal_1262
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Csal_1262
Enzymes [BR:csa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Csal_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1440677..1441492
Genome map
AA seq 271 aa AA seqDB search
MNRIDKRFAALKSQQRRALIPYITAGDPAPQHTVGFMHACVEAGADVLELGVPFSDPMAD
GPVIQKACERALAKGTRLTDVLDMVATFRATDAETPVVLMGYLNPVERMGYEHFARRARE
AGVDGVLMVDMPPEEMAEVAPLFSEHGLQSIFLLAPTTSPSRAATICRHGEGYLYYVSLK
GVTGAASLDVDAVERQLAPLREMTDLPLCVGFGIRDGDTAAAVGRVADGVIVGSALVSRI
AENAETPEAIPAALKAVLGDMRDALDRSDGR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatcgataaacgcttcgcggcgctcaagtctcaacagcgccgcgcgttgatt
ccttatatcaccgcgggcgatccggcgccgcagcataccgtggggttcatgcacgcctgc
gtcgaggctggcgccgacgtgctggagctgggcgtgccgttttccgaccccatggccgat
ggcccggtgatccagaaagcctgcgagcgtgcgctcgccaagggcacgcggttgaccgat
gttctcgacatggtcgcgacgtttcgcgccaccgatgcggaaacgcccgtggtcctgatg
gggtatctcaaccccgtcgagcgcatgggatacgagcatttcgcgcggcgcgcgcgggag
gcgggcgtcgacggcgtgctgatggtcgacatgccgccggaggagatggctgaggtcgca
ccgctgttctccgagcacgggctgcagtcgatctttctgcttgcccctaccacctcgccg
tcgcgggccgctacaatatgtcgacatggcgaaggctatctgtactacgtatcgctcaag
ggcgttaccggtgccgcctcgctggacgtcgatgccgtcgagcgccagttggcgccgctt
cgcgagatgaccgacctgccgctatgcgtcgggttcgggattcgggatggcgacacggcg
gcggcagtgggccgggtggccgacggggtcatcgtcggcagtgctctggtgtcgcgcatc
gccgaaaacgccgagacccccgaggccataccggcggcgctcaaggcggtgctcggcgac
atgcgcgatgcgctggaccgttccgacggccgctga

DBGET integrated database retrieval system