KEGG   Chromohalobacter salexigens: Csal_1262Help
Entry
Csal_1262         CDS       T00347                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:csa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:csa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:csa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1440677..1441492
Genome map
AA seq 271 aa AA seqDB search
MNRIDKRFAALKSQQRRALIPYITAGDPAPQHTVGFMHACVEAGADVLELGVPFSDPMAD
GPVIQKACERALAKGTRLTDVLDMVATFRATDAETPVVLMGYLNPVERMGYEHFARRARE
AGVDGVLMVDMPPEEMAEVAPLFSEHGLQSIFLLAPTTSPSRAATICRHGEGYLYYVSLK
GVTGAASLDVDAVERQLAPLREMTDLPLCVGFGIRDGDTAAAVGRVADGVIVGSALVSRI
AENAETPEAIPAALKAVLGDMRDALDRSDGR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatcgataaacgcttcgcggcgctcaagtctcaacagcgccgcgcgttgatt
ccttatatcaccgcgggcgatccggcgccgcagcataccgtggggttcatgcacgcctgc
gtcgaggctggcgccgacgtgctggagctgggcgtgccgttttccgaccccatggccgat
ggcccggtgatccagaaagcctgcgagcgtgcgctcgccaagggcacgcggttgaccgat
gttctcgacatggtcgcgacgtttcgcgccaccgatgcggaaacgcccgtggtcctgatg
gggtatctcaaccccgtcgagcgcatgggatacgagcatttcgcgcggcgcgcgcgggag
gcgggcgtcgacggcgtgctgatggtcgacatgccgccggaggagatggctgaggtcgca
ccgctgttctccgagcacgggctgcagtcgatctttctgcttgcccctaccacctcgccg
tcgcgggccgctacaatatgtcgacatggcgaaggctatctgtactacgtatcgctcaag
ggcgttaccggtgccgcctcgctggacgtcgatgccgtcgagcgccagttggcgccgctt
cgcgagatgaccgacctgccgctatgcgtcgggttcgggattcgggatggcgacacggcg
gcggcagtgggccgggtggccgacggggtcatcgtcggcagtgctctggtgtcgcgcatc
gccgaaaacgccgagacccccgaggccataccggcggcgctcaaggcggtgctcggcgac
atgcgcgatgcgctggaccgttccgacggccgctga

DBGET integrated database retrieval system