KEGG   Chromohalobacter salexigens: Csal_1392Help
Entry
Csal_1392         CDS       T00347                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
csa  Chromohalobacter salexigens
Brite
Enzymes [BR:csa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Csal_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1582556..1583029)
Genome map
AA seq 157 aa AA seqDB search
MSLKRRLIVGGTAGALSLATAVVSQFEGYRSEAYRDPVGIPTICYGHTGDVDMGQTLSQS
ECKELLAEDLGTAFDAVDQRVEVELPPARRAALASFVYNVGEGKFARSTLLKRLNAGKVR
AACDELNRWVYAGGRKLAGLVKRRAAERKLCLRGLDP
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttaaacgccgcctcatcgtcggcgggaccgccggcgcgctcagcctcgccacc
gccgtcgtctcacagttcgaagggtatcggtcggaggcctaccgagaccccgtaggcatt
ccgaccatctgttatggccacaccggcgatgtcgatatgggccagacactgagccaatcc
gagtgcaaggaattgctcgctgaggatctcggcacggccttcgacgccgtcgaccagcgc
gtcgaagtcgagctgcccccggcgcgtcgcgcggccttggcctcgttcgtctacaacgtc
ggcgaaggtaaattcgcccgctcgactctgctgaagcgactgaacgccggcaaagtgcgc
gccgcctgcgacgagctcaaccgctgggtctacgccgggggccgtaagctcgcaggcttg
gtcaagcgccgcgccgctgaacgcaagctgtgcctgcgggggctcgatccgtga

DBGET integrated database retrieval system