KEGG   Chromohalobacter salexigens: Csal_1426Help
Entry
Csal_1426         CDS       T00347                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Csal_1426
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_1426
  Lipid metabolism
   00071 Fatty acid degradation
    Csal_1426
  Amino acid metabolism
   00350 Tyrosine metabolism
    Csal_1426
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Csal_1426
   00626 Naphthalene degradation
    Csal_1426
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Csal_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1614373..1615371
Genome map
AA seq 332 aa AA seqDB search
MKAMVLERRGGPLQERERPVPVPGPGQVLLKVEACGVCRTDLHLLDGELPDILYPIVPGH
EIIGRVAGCGPGVTLSHGVRLGVPWLGYSCGECWYCLHEQENLCDRARFTGYQIDGGFAD
YTLADHRFCLPVNPDCDAAEAAPLMCAGLIGYRALNMCGSGLQRLGIYGFGAAAHIVAQV
VLWQGVELYAFTRPGDEEGQEFARHMGAIWAGDSHQLPDLPLDAAIIFAPVGELVPAALR
AVRKGGVVVCGGIHMSDIPTFPYALLWGERQLRSVANLTRKDGENFLGLISKVAIDTHIE
RYPLHAANQALRDLKEGRLQGAAVLEMAGTAD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccatggtactcgagagaagaggtgggccacttcaagagcgggagcgacctgtt
cctgtacctggccctgggcaggtgttgctcaaggttgaagcctgtggagtatgccgcacc
gacctgcatttgttggatggtgagctgccggacattctctatcctatcgtccctggacat
gaaatcattggccgcgttgcgggttgtggccccggcgtcacgctctctcatggggtacgc
ctgggcgttccgtggctggggtacagctgtggtgagtgctggtattgtctgcacgagcaa
gaaaacctatgtgaccgggcccgctttaccggttatcaaattgatggtggctttgcggac
tataccctggcggatcaccgcttctgccttcctgtcaatcctgattgcgatgcagctgaa
gcggcaccgttaatgtgtgctggcctgatcggctaccgtgctttaaacatgtgcggcagt
ggcctgcaacgcctgggcatctatggctttggcgctgcagctcatatcgtggctcaagtt
gttttatggcagggcgtcgaattgtatgcctttactcgaccgggagacgaggaagggcaa
gaatttgcgcgtcacatgggggcaatctgggcaggggattcccaccaactgcccgatctg
ccattggatgcagcgatcatatttgcacccgtaggtgagcttgtacccgctgcgctgcgc
gccgtgcgtaaaggcggggtggtcgtttgtggtggcattcatatgagtgacattcccacc
tttccctacgcgctgctctggggcgagcgtcagttgcgctcggtcgccaacctgacccgt
aaggacggtgaaaacttccttggcctgatctcaaaagtcgcaatcgacacccatatagag
cggtatccgcttcatgccgccaaccaggcactcagagacctcaaggagggcaggttgcag
ggggctgccgtgctggaaatggcgggaactgctgattga

DBGET integrated database retrieval system