KEGG   Chromohalobacter salexigens: Csal_1446Help
Entry
Csal_1446         CDS       T00347                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:csa00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:csa00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:csa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:csa00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1635666..1636673)
Genome map
AA seq 335 aa AA seqDB search
MIALLTLALSSSVHAATELSASERQAIEARVQTLETELRDLRQTLAEDASATEADASPAE
REAQNLETRVDKRRELERESSRNPLAVTTYRRNYLLPWAYNANPDQDRFAEVTDATDADN
TEVKYQLSFKVNLIEDLFDDNGDVYFAYTQRSWWQAYNSEASAPFRETNYEPEAFISFDN
SMSALGWTNTINRLGFAHQSNGRSDPLSRSWNRVYADMVFQRGEWAVSVAPHWRVPENEE
DDDNPDLEDYIGYGDVTLVRAFGDQEVSLLMRGNPGKSHYGAQLDYSFPLFGKVRGYVQY
YHGYGESLIDYDHINRRLGLGFSINTFLAGIPGLD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgctgctcaccctggcgctttccagctccgtgcatgccgccaccgagctgagc
gccagcgagcgccaggccatcgaggcgcgcgtgcagacgctggagacggaactgcgcgac
ctgcgtcagacgctggccgaggatgccagcgcgacagaagccgatgccagcccggcggaa
cgcgaggcgcagaatctggaaacccgcgtcgacaagcgtcgcgagctcgagcgcgagtct
tcgcgcaatcccctggcggtgaccacctaccggcgcaactatctgctgccgtgggcctat
aacgccaaccccgaccaggatcgcttcgccgaagtcaccgacgccaccgatgccgacaac
accgaagtcaagtatcagctgagcttcaaggtcaacctgatcgaagatctcttcgacgac
aacggcgacgtgtacttcgcctacacgcagcgcagctggtggcaggcttacaactccgag
gcctcggcccccttccgcgagaccaattacgagcccgaggcgttcatcagtttcgacaac
agcatgagcgcgctgggctggaccaacaccatcaatcgtctcggctttgcgcaccagtcc
aacggccgttccgatccgttatcgcgcagctggaaccgcgtctacgccgacatggtgttc
cagcgcggcgaatgggcggtgagcgtggcgccccactggcgagtccccgagaacgaggaa
gacgatgataacccggacctcgaggactacatcggctacggcgacgtcacgctggtccgc
gccttcggcgaccaggaagtttcgctgctgatgcgcggcaatcccggcaagagtcattac
ggggcgcaactggactactcgtttccgctattcggcaaggtgcgcggttacgttcagtac
taccacggctacggcgagagcctgatcgactacgatcacatcaaccgtcgcctggggctc
ggcttcagcatcaacaccttcctggcgggcattcccggactggattga

DBGET integrated database retrieval system