KEGG   Chromohalobacter salexigens: Csal_1460Help
Entry
Csal_1460         CDS       T00347                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
csa  Chromohalobacter salexigens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:csa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1654601..1655212
Genome map
AA seq 203 aa AA seqDB search
MAFSPLVDQLLETLRVLPGVGPKTAQRMALHLLERDRDGGRRLVAALGEALEHVGYCQRC
RTLAETPLCSICEDARRDEGLLCVVESPADMLAIEQAGGFRGLYFVLHGHLSPLDGIGPE
DIGLDQLDERLAGGSVEEVILATNPTVEGEATAHYIAEQLRGTGVRLSRLAYGVPMGGEL
EYVDGGTLSRAFNGRLPFAQESS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttctcctctcgtcgatcagttgttggagacgctgcgcgtgttgcccggggtc
ggccccaagaccgcgcagcgcatggcattgcatcttctggaacgcgaccgtgacggcggt
cgccgtctggtcgccgcgctgggcgaggcactggaacacgttggctattgtcagcgttgc
cggacgctggccgagacgccgctatgcagcatctgcgaggatgcgcgccgcgatgaaggc
ctgctgtgcgtggtcgagtcgcccgccgacatgctcgccatcgagcaggccggtgggttt
cgcggcctctatttcgttctgcatggccacttgtcgccgctggacggcatcggtcccgag
gacatcggactcgatcagctcgatgagcggcttgcgggcggcagtgtcgaggaagtgatc
ctggccaccaatccgaccgtggaaggcgaagcgacggcgcattacatcgccgagcagctg
cggggcaccggcgtgcggctgtcgcgcctggcatacggcgtgcccatggggggcgagctc
gaatacgtggatggcggcaccttgagccgtgccttcaacggccgcctgccgtttgcgcaa
gagtcgagctga

DBGET integrated database retrieval system