KEGG   Chromohalobacter salexigens: Csal_1534Help
Entry
Csal_1534         CDS       T00347                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csal_1534
   01230 Biosynthesis of amino acids
    Csal_1534
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_1534
   00030 Pentose phosphate pathway
    Csal_1534
   00051 Fructose and mannose metabolism
    Csal_1534
   00052 Galactose metabolism
    Csal_1534
  Energy metabolism
   00680 Methane metabolism
    Csal_1534
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Csal_1534
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Csal_1534
Protein phosphatases and associated proteins [BR:csa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Csal_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1746436..1747695)
Genome map
AA seq 419 aa AA seqDB search
MAQHNAFYAQSGGVTAVINASACGVIETCRRHSDKIGKVYAGHNGIIGALTEDLIDVSQE
SDEAIAALRHTPGGAFGSCRYKLKDIETHRAQYERLIEVFKAHDIRYFFYNGGGDSADTC
LKVSQLSEKMGYPLTAIHVPKTVDNDLPITDNSPGFGSVAKYIATSTREAALDIASMCAT
STKVFVLEVMGRHAGWIAAAGALAGNGEGEPPHLVIFPELPFQRARVMQRVDEAVKKYGY
CVIVVSEGARYEDGTFLADAGNTDAFGHRQLGGVAPTLAGMIKQDLGYKYHWAVADYLQR
AARHLASRTDVEQAYAVGQKAVELALEGRNAMMPTIKRVSETPYEWRIDAAPLAEVANKE
KFMPRDYIREDGFGITEAGRRYLSPLIQGEDFPPFENGLPKVAKLDKVKVPRKLPAFEL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcacaatgccttttacgcccagtccggtggcgtcaccgccgtcatcaacgcc
agcgcctgcggcgtcatcgagacctgtcgtcgccattcggacaagatcggcaaggtctac
gccggccacaacggcatcatcggcgccctgaccgaggatctcatcgacgtttcccaggaa
agcgacgaggcgattgccgcactgcgccatacgccgggcggcgcgttcggttcctgccgc
tacaagctcaaggacatcgagacgcatcgcgcgcaatacgagcgcctcatcgaggtattc
aaggcgcatgacatccgctacttcttctacaacggcggcggcgacagcgccgatacctgc
ctcaaggtgtcgcagctctcggaaaagatgggctacccgctgactgcgattcacgttccc
aagaccgtcgacaacgacctgccgatcaccgacaactctcccggcttcggcagcgtggcc
aagtacatcgccacctcgacccgcgaagcggcgctggatatcgcttccatgtgcgccact
tccaccaaggtgttcgtgctcgaagtgatgggccgtcatgcgggctggatcgccgcggcc
ggcgccctggcgggcaacggcgaaggcgagccccctcacctggtcatcttccccgagctc
cccttccagcgcgcccgggtcatgcagcgcgtcgacgaggccgtcaagaagtacggctat
tgcgtcatcgtggtctccgagggcgcccgttacgaagacggcaccttcctcgccgacgcc
ggcaataccgacgccttcggccaccgtcagctgggcggcgtggcgccgacgctcgccggc
atgatcaagcaggacctgggctacaagtaccactgggcggtggccgactacctgcagcgt
gccgcacgccatctggcctccagaaccgacgtcgagcaggcctatgcggtggggcagaag
gccgtcgagctggccctggaaggcaggaatgccatgatgccgaccatcaagcgcgtcagc
gagacgccctacgaatggcgcatcgatgcggcgccgctggccgaagtggccaacaaggag
aagttcatgccccgcgactacatccgcgaggacggcttcggtatcacggaggcgggtcgc
cgctatctgtcaccgctgatccagggcgaggatttcccgccgttcgaaaacggcctgccc
aaggtggccaagctcgacaaggtcaaggtgccgcgcaagctgcccgccttcgagctctga

DBGET integrated database retrieval system