KEGG   Chromohalobacter salexigens: Csal_1593Help
Entry
Csal_1593         CDS       T00347                                 

Definition
ribosomal large subunit pseudouridine synthase C
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
csa  Chromohalobacter salexigens
Brite
Enzymes [BR:csa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     Csal_1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1815843..1816790
Genome map
AA seq 315 aa AA seqDB search
MAEGRDVQWVEVSEGQVGQRIDNFLRTRLKGAPKSLIYRIVRKGEIRVNKKRVKADYRLE
LGDLVRIPPLRLAPEEAVREVSDGLRNLLAGSVLVEGPAWLVINKPAGLAVHGGSGVKIG
LIEALRQVRDDLDFLELVHRLDRDTSGCLLLAKSRTALVTLNQALKAHQMDKQYLALVQG
RWPTRREFVSARLDRFDAGNGERRVRVDSQGKVSRTRFAVREAFSRVTLIEAEPVTGRTH
QIRVHAAHAGHALLGDDKYGTREGARLARELKLERLFLHSNALTFPEPSSGRPVHVKAPL
GETLEAVLARARQAR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaggccgcgacgtacagtgggtggaagtgagtgaagggcaggtcggtcagcgg
atcgacaatttcttgcgcacacggctcaagggtgcgcccaagtcgttgatctatcggatc
gtgcgcaagggggagattcgcgtcaacaagaagcgggtcaaggccgactatcgcctggag
ctgggcgatctggtgcgtatcccgccgctgcggctggcacccgaggaggcggtccgcgaa
gtcagcgacggattgcgcaacctgctggcgggcagcgtgctggtcgaagggccggcctgg
ctggtgatcaacaagccggccgggctcgccgtgcatggtggcagcggggtgaagatcggc
ttgatcgaggccctgcgtcaggtgcgcgacgatctggacttcctcgagctggtgcaccgc
ctggatcgcgacacgtccgggtgcctgctgctggccaagtcacgtacggcgttggtgacc
ttgaaccaggcgctcaaggcacaccagatggacaagcagtacctggcgctggtgcagggg
cgctggccgacgcggcgcgagttcgtcagcgcgcggctcgatcgtttcgatgcgggcaat
ggcgagcggcgagtgcgggtcgacagtcagggcaaggtgtcgcgcacgcgcttcgccgtg
cgcgaggccttttcgcgtgtcaccttgatcgaggccgagccggtcaccgggcgcacgcac
cagatccgcgtccatgccgcacatgccgggcacgccctgttgggtgacgacaagtacggc
acccgcgagggcgcgcgtctggcgcgcgagctcaagctggagcgcctgttcctgcactcc
aacgccttgacgttccccgagcccagcagcggccgtccggtgcacgtcaaggcgccgctc
ggggagaccctcgaggcggtgctggcgagggcgcggcaagcgcgctga

DBGET integrated database retrieval system