KEGG   Chromohalobacter salexigens: Csal_1841Help
Entry
Csal_1841         CDS       T00347                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csa  Chromohalobacter salexigens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Csal_1841
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Csal_1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2097661..2098554)
Genome map
AA seq 297 aa AA seqDB search
MLYNYGSINIDHVYRVSHLVRPGETLSSQSYTQVLGGKGANQSLAMARAGGEVTHWGRLS
QSDRWALETLARAGVNTSLIELTADASGHAIIQVDDHAENAIILNPGANHGFSERHIEAL
MTSVQPGDWLLLQNECNALGTVMTLAARHGMRIAFNPAPLGANVHSLPLELCQVLFLNRG
EAAALAGLEDNAEVDALLDVLSRRLPDVELVLTLGRDGVCYQWGEQRLALPALPVEAVDT
TAAGDTFIGYFMAARQREASIDTCLREASAAAALCVQRAGAAPSIPLASDVAASFHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaattacggttccatcaacatcgaccatgtctaccgcgtcagccatctggtg
agacccggtgaaacgctgtcgagtcagagctatacccaggtgctgggcgggaaaggcgcc
aatcaatcgctggccatggcacgtgcgggcggcgaggtcacgcactggggacgtctctcg
caaagcgatcgctgggcgcttgagacccttgcccgcgccggcgtcaacacctcgctcatc
gaactcaccgccgatgccagcgggcacgccatcatccaggtcgacgatcacgccgaaaac
gccatcattctcaacccgggcgccaatcacggcttcagcgagcgtcatatcgaggccttg
atgacctcggtgcagccaggcgactggctgctgctgcagaacgaatgcaacgccctgggc
accgtcatgacgctggccgcgcgccacggcatgcgcatcgcgttcaatcccgcgccgctc
ggtgccaacgtgcattcgctgccgctggaactgtgccaggtgctgtttctcaatcgaggc
gaggcggcggccttggcggggctcgaagacaatgccgaggtcgacgcactcctggacgtg
ctgtcacgacggttgcccgacgtcgagctggtgctgaccctggggcgcgatggcgtctgc
tatcagtggggcgagcagcgtctggccttgcccgccctgccggtcgaagcggtcgacacg
accgccgccggcgacaccttcatcggttatttcatggccgcccgccagcgcgaagcgtcc
atcgatacgtgtctgcgcgaagccagcgccgccgctgcattgtgcgtacagcgagccggt
gccgcgcccagcattccgctggccagcgacgtcgcggcgtccttccatgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system