KEGG   Chromohalobacter salexigens: Csal_1847Help
Entry
Csal_1847         CDS       T00347                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
csa  Chromohalobacter salexigens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Csal_1847
Enzymes [BR:csa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Csal_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2103331..2103951
Genome map
AA seq 206 aa AA seqDB search
MCMIGRLRGTLLEKQPPWIVVDVGGVGYELETSMTTLLALPGPGEEVQLHTHLAVREDAH
LLYGFARGDERQLFRALIKVNGVGPKLALAILSGMDQEAFIRCVMEDDIKALTRLPGVGK
KTAERLVVEMRDRFPHWQLEQENGLHALELGASPTTAAPDPQADAESALVALGYKPTEAS
RMLSGLDDGLSTEGLIKAALARKLAG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatgatcggacgcttgcgtggcaccctgctggagaaacaaccgccgtggatcgtg
gtcgatgtcggcggtgtcggctatgagctggaaacttccatgaccaccttgctggccctg
ccggggccaggcgaggaagttcagctgcatacgcatctggcggtgcgcgaggacgcgcat
ctcctctacggcttcgcgcgaggcgacgagcggcaactgttccgtgccctgatcaaggtc
aatggtgtcggccccaagctggcgctggcgattctctcgggcatggaccaggaagccttc
atccgctgcgtcatggaagatgacatcaaggcgctgacgcgcctgccgggtgtcggcaag
aaaaccgccgagcggctggtggtggaaatgcgcgaccgctttccgcactggcagctcgag
caggaaaacgggctgcacgctctcgagctgggcgcctcgccgacgactgccgcgcccgat
ccccaggccgatgccgaatcggcgctggtggccttgggctacaaacccaccgaagcctcg
cgcatgctgtccgggctcgatgacggcctctcgacagagggcctgatcaaagctgcgctg
gcccgcaagctggctggctaa

DBGET integrated database retrieval system