KEGG   Chromohalobacter salexigens: Csal_1859Help
Entry
Csal_1859         CDS       T00347                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
csa  Chromohalobacter salexigens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Csal_1859
   00052 Galactose metabolism
    Csal_1859
   00500 Starch and sucrose metabolism
    Csal_1859
   00520 Amino sugar and nucleotide sugar metabolism
    Csal_1859
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Csal_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2112896..2113783
Genome map
AA seq 295 aa AA seqDB search
MIKKAVLPVAGLGTRCLPASKAIPKEMITIVDKPVIQYVVEEAVAAGIKEIVLVTHSSKS
AIENHFDKNFELESMLEAKGKDELLAEVRNIVPDDVSIIAVRQPVALGLGHAVLCAQSVI
GDDPFAVLLPDVLVDAEGLPENDLAGMIHAFDKSGQAQIMVENVPHELTYKYGIVALDGE
TPAPGVSAPLSGMVEKPKVEEAPSSLAVIGRYLLPAAIFPLLAETTPGAGNEIQLTDALE
TLRQQQGAEAYRMRGKTYDCGHQLGYLEATLALAKRHPQHGEGFRALLSRYADEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaggccgtactccccgtcgctggtctcggtacgcgttgcctgccggcctcc
aaggccattcccaaggaaatgatcaccatcgtcgacaagccggtcatccagtatgtcgtc
gaggaggccgtcgcggccggcatcaaggagatcgtcctggtgacgcactccagcaagagt
gccatcgaaaaccacttcgacaagaacttcgagctcgaatccatgctcgaggccaaggga
aaggacgagctgcttgcggaagtccgcaacatcgtgcccgacgatgtcagcatcatcgcc
gtgcgccagccggtcgccctggggctgggccacgcggttctctgcgcgcagtcggtgatc
ggcgacgacccgttcgcggtgctgttgcccgatgttctggtcgatgcggagggactgccg
gaaaacgacctggccggcatgatccacgccttcgacaagagcgggcaggcccagatcatg
gtcgagaacgtgccgcacgaactgacctacaagtacggcatcgtcgccctggatggcgag
acgcccgcaccaggcgtcagcgcccccctgagcggcatggtcgagaagcccaaggtcgag
gaggccccctccagcctggcggtgatcggtcgttacctgctgccggcggcgatcttcccg
ctactggccgaaacgacgcccggcgcgggcaacgagatccagttgaccgacgcgctcgaa
acgctgcgccagcagcagggggccgaggcctaccgcatgcgtggcaagacctatgactgc
ggtcaccagttgggctatctcgaagccaccttggcgttggccaagcgccatccccagcat
ggcgaaggattccgcgccttgctgagccgctacgccgacgagggctga

DBGET integrated database retrieval system