KEGG   Chromohalobacter salexigens: Csal_2393Help
Entry
Csal_2393         CDS       T00347                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
csa  Chromohalobacter salexigens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csal_2393
   01212 Fatty acid metabolism
    Csal_2393
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Csal_2393
   00650 Butanoate metabolism
    Csal_2393
  Lipid metabolism
   00071 Fatty acid degradation
    Csal_2393
   01040 Biosynthesis of unsaturated fatty acids
    Csal_2393
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Csal_2393
   00310 Lysine degradation
    Csal_2393
   00380 Tryptophan metabolism
    Csal_2393
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Csal_2393
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Csal_2393
   00281 Geraniol degradation
    Csal_2393
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Csal_2393
   00930 Caprolactam degradation
    Csal_2393
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Csal_2393
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Csal_2393
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Csal_2393
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Csal_2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2683196..2685379)
Genome map
AA seq 727 aa AA seqDB search
MIYQGNAITVVQRDDGIATLTFDAQGESVNTLSSKTIEEFEAALAALDQAAGVKGLVIAS
AKDAFIVGADITEFHGMFTRDEAFLVDMNTRVHRIFNTLEDLPYPSVAAINGLALGGGCE
ITLACDFRVMSDNAKLGLPETKLGILPGWGGCVRLPRLIGADNAIEWIAGGSENRADDAL
KVGAVDAVVSGDALMNAAVDLLTRANAGELDHRARRRLKQSPLMLNAIEQMMVFETAKGY
VAGKAGPHYPAPIEAIKVIQKGAGEERERAQAIEAKAFAKLAKTDVCYHLVGLFLNDQLV
KKKGKQYAMQAAAVNKTAVLGAGIMGGGIAYQSAYKGTPILMKDIKEEALQLGLKEARKL
LGKQLERGRLSNEQVAEALCNIRPTLSYGDFGDVDLVVEAVVENPKVKEAVLAEVEGLLD
DNATLTSNTSTISIDRLAANLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDAAVAATVA
YARQMGKTPIVVNDCPGFLVNRVLFPYFGGFSQLVEQGADFERVDKVMEGFGWPMGPAYL
LDVVGMDTAVHAQSVMAEGFPDRMAQEARNGGKTAIQRMYDEDRLGQKNGKGFYRYEEDK
KGKPKKVSDEQAHALVDEGVDTRREFSDDEIVARMMVPLCMEAVRCLEDGIVATPAEADM
ALIYGIGFPPFRGGALRYIDALGVEAFVSQAEALADELGPLYRPTERLRDMAAKGERFYP
ATSESDH
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggtaacgccatcacggtggtgcagcgcgatgacggcatcgccacgctg
accttcgatgcgcaaggcgaatccgtcaacacgctctcgagcaagacgatcgaggagttc
gaggcggccctggcagccctcgaccaggcagcgggcgtcaagggcctggtcatcgccagc
gccaaggatgccttcatcgtcggggccgacatcaccgaatttcacggcatgttcacgcgc
gacgaagccttcctggtcgacatgaacacgcgcgtgcaccgtatcttcaataccctggag
gatctgccttatcccagcgtggcggcgatcaacggcctggcgctcgggggcggctgcgaa
atcaccctggcgtgcgatttccgcgtcatgagcgacaacgccaagctgggcctgcccgag
accaagctggggatcctgccgggctggggcggctgcgtgcgcctgccgcgcttgatcggg
gcggacaacgccatcgagtggatcgccggtggctcggaaaaccgcgccgacgacgccctc
aaggtcggcgcggtggatgccgtggtctcgggcgatgcgctgatgaatgcggccgtggac
ctgctgacgcgcgccaatgccggcgagctcgaccaccgggcacgtcgccgcctcaagcaa
tccccgctcatgctcaatgccatcgaacagatgatggtcttcgagaccgccaagggctac
gtggcgggcaaggccgggccgcactatccggcgcccatcgaggcgatcaaggtcatccag
aagggcgccggcgaggagcgcgagcgcgcgcaggccatcgaggccaaggccttcgccaag
ctcgccaagaccgatgtctgctaccacctggtggggctgttcctcaacgatcagctggtc
aagaagaaaggcaagcagtacgccatgcaagccgcggccgtgaacaagacggcggtgctg
ggggccggcatcatgggcggcggcatcgcctaccagagcgcctacaagggcactccgatc
ctgatgaaggacatcaaggaagaggcgctgcagctgggcctgaaggaagcgcgcaagctg
ctcggcaagcagctcgagcgcggtcgattgagcaatgagcaggtcgccgaggcgctctgc
aacattcgccccacgctgtcctacggggacttcggcgatgtcgatctggtggtcgaggcc
gtggtcgagaacccgaaggtcaaggaggccgtgctggccgaggtcgagggactgctcgac
gacaatgccacgctgacctcgaacacctcgacgatctccatcgaccggctggcggccaac
ctcaagcgtcccgagaacttctgcggcatgcacttcttcaaccccgtgcatcgcatgccg
ctggtcgaggtcattcgcggcgagaagaccagcgacgccgccgtggccgcgactgtggcg
tacgcccgtcagatgggcaagacccctatcgtggtcaacgactgcccgggtttcctggtc
aatcgcgtgctgtttccctatttcggcggcttcagccagctggtcgagcagggcgcggac
ttcgagcgcgtcgacaaggtcatggaaggcttcggctggccgatgggcccggcctatctg
ctggatgtcgtgggcatggacaccgccgtgcacgcccagtcggtgatggcggaaggcttt
cccgatcgcatggcgcaggaagccagaaacggtggcaagacggcgattcagcgcatgtac
gacgaggaccgcctgggccagaagaacggcaaggggttctaccgctacgaggaggacaag
aagggcaagcccaagaaagtctccgatgagcaggcgcatgcgctggtcgatgaaggcgtc
gacacgcgccgcgagttcagtgacgacgagatcgtcgcgcgcatgatggtgccgctgtgc
atggaggccgtgcgctgcctggaagacggcatcgtggcgacgcccgccgaggcggacatg
gcgctgatctacggcatcggcttcccgccgttccggggtggggcgctgcgctacatcgac
gccctgggcgtcgaggcgttcgtttcccaggccgaggcgctggccgacgagctggggccg
ctgtatcgccccaccgagcggctgcgcgacatggcggccaagggggaacgtttctacccc
gcgacgtccgaatccgaccactga

DBGET integrated database retrieval system