KEGG   Chromohalobacter salexigens: Csal_2449Help
Entry
Csal_2449         CDS       T00347                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
csa  Chromohalobacter salexigens
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csal_2449
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Csal_2449
Enzymes [BR:csa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Csal_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2754022..2755332
Genome map
AA seq 436 aa AA seqDB search
MSQTREQQIAALEKDWNENPRWKDVKRPYSAEDVVRLRGSVNEAHTLASRGAEKLWRLVN
GEARKGYVNCLGALTGGQAMQQVKAGIEAIYLSGWQVAADNNSYLSMYPDQSLYPVDSVP
KVVERINNSFRRADQIQWQKGANPGDADFVDYFAPIVADAEAGFGGVLNAYELMTAMIRA
GASGVHFEDQLAAVKKCGHMGGKVLVPTQEAVQKLVAARLAADVAGTPTLVIARTDANAA
NLITADVDDYDKPFITGERTAEGFYRVNAGLDQAISRGLAYAPFADIIWCETAKPDLDEA
RRFAEAIHREYPGQLLAYNCSPSFNWKKNLDDAEIAGFQQALADMGYTYQFITLAGIHNM
WYNMFDLAHSYAQGEGMKHYVEKVQQPEFEAAERGYTFVAHQQEVGTGYFDDMTNVIQGG
VSSVTALKGSTEEAQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagacacgcgaacagcaaatcgctgcgttggaaaaggattggaacgagaatccg
cgctggaaggacgtcaagcgtccgtacagtgccgaagatgtggttcgacttcgcggcagc
gtcaacgaagcgcacacgctggccagccgcggcgccgagaagctctggcgactggtcaat
ggcgaggcccgcaagggctacgtcaactgcctcggcgcgctgaccggcggccaggccatg
cagcaggtcaaggcaggtatcgaggcgatctatctctcgggctggcaggtcgccgccgac
aacaacagctacctgtcgatgtatcccgaccagtcgctctatccggtggactcggtgccc
aaggtcgtcgaacgcatcaacaacagtttccgccgcgcggatcagatccagtggcagaag
ggcgccaaccccggcgatgccgacttcgtcgattacttcgcccccatcgtcgccgacgcc
gaggcgggattcggcggcgtgctcaacgcctatgaactgatgacggcaatgatccgtgcc
ggtgccagtggcgtgcatttcgaggatcagctcgccgcggtcaagaagtgcggccacatg
ggcggcaaggtgctggtgcccacgcaggaggccgtgcagaagctggtcgccgcccgtctg
gccgccgacgtcgcgggcacgccgacgctggtcatcgcgcgcaccgacgccaatgccgcc
aacctgatcaccgccgacgtggatgattacgacaagcccttcatcaccggggaacgcacc
gccgaaggcttctatcgggtcaatgccggcctcgatcaggccatctcgcgaggcctggcc
tacgcgcccttcgccgacatcatctggtgcgaaaccgccaagccggatctcgacgaagcc
aggcgcttcgccgaggcgatccatcgcgaatatccggggcaactgctcgcctacaactgc
tcgccgtccttcaactggaagaagaacctcgacgatgccgagatcgccgggttccagcag
gccctggccgacatgggctacacctaccagttcatcaccttagcgggcattcacaacatg
tggtacaacatgttcgatctcgcccacagctacgctcagggcgaaggcatgaagcactac
gtcgagaaggtccagcagccggaattcgaggccgccgaacgcggctacaccttcgtcgct
caccagcaggaagtgggcaccggctacttcgacgacatgaccaacgtcatccagggcgga
gtgtcgtcggtgaccgccctcaagggctccaccgaggaagcgcagttctga

DBGET integrated database retrieval system