KEGG   Chromohalobacter salexigens: Csal_2588Help
Entry
Csal_2588         CDS       T00347                                 

Definition
(GenBank) alpha amylase
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Csal_2588
Enzymes [BR:csa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Csal_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CT_C_D
Motif
Other DBs
NCBI-ProteinID: ABE59935
JGI: Csal2588
UniProt: Q1QUC3
Position
2900289..2902085
Genome map
AA seq 598 aa AA seqDB search
MPHPMSHAPQRQLDEAEFVDRARARLNEIYGPRADEVLRRLQRLVAHQRGAIPERPRPLW
SERDQLLITYGDLLLDGEHPPLQVLDEFLETRLADTFSGVHVLPFFPWSSDDGFSVIHYR
EVNPALGDWDDIRRLARHGDLMVDLVINHVSRESLWFVDYLAGTQPGRDYFIEMDPATDL
SQVTRPRNSPLLVPVSTRRGTRYLWATFSEDQIDLNFANPDVLIEFIGIMLYYVAQGARI
IRLDAIAYLWKQVGTACIHLPETHAVVRLLRAVLDHLAPGTLLITETNVPHRENMSYFGL
ERLATASPDATAQPDEAHMIYQFTLPPLLVHTLTSGDATALEAWARSLPSLPPGCTYFNF
TASHDGIGVRALEGLLPPHEIEAMLELMHRFGGYVSMKADADGKDSPYEVNITYFDALRG
TRRGADPWQVERFLCSQHLMLALQGIPGIYFHCLTATLNDHEGVERSGQLRTINRRRWQK
EELDELLDSRNTPTREVFLALRRRLKLRAQEPCFHPQAAQRIVTTPPTLFAVQRGPLDDG
RRLLAIYNVTDKRQPLEVAELDEGSWYDLLADAPWDASAPRELRPYRSLWLVQRPGAD
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccccatgtcccacgctccgcagcgtcaactcgatgaagccgagttcgtcgac
cgcgctcgggcacgcctgaacgagatctacggccctcgcgccgacgaggtgctgcgccga
ttgcagcgactggtggcgcaccagcgcggtgcgattcccgaacgcccgcgtccattgtgg
agcgagcgcgaccaattgctcatcacctacggcgacctcctgctcgacggcgaacaccct
ccgctgcaagtgctcgacgaatttttggagacccggctcgcggataccttcagcggcgtg
cacgtcctgccgttcttcccctggagcagcgacgacgggttttcggtcattcattatcgc
gaggtcaaccctgcgctgggcgactgggacgacattcgccgcctggcccgtcacggcgac
ctgatggtcgacctggtgatcaatcatgtctcgcgggaatcgctgtggttcgtcgactac
ctcgcgggcacgcagccgggccgcgactatttcattgaaatggaccccgccaccgacctg
tcgcaagtcacgcgcccgcgcaattcgccgctgctggtgccggtctccacgcgccgtggc
acgcgctacctgtgggccaccttctccgaagaccagatcgacctgaacttcgccaatccc
gatgtgctcatcgaattcatcggcatcatgctctattacgtggcgcaaggcgcgcgcatc
atccgtctcgacgccatcgcctatctgtggaagcaggtcggcaccgcctgcattcatctg
ccggaaacgcatgccgtggtgcgcctgctgcgcgccgttctcgatcacctcgcccccggt
accctgctgatcaccgaaaccaacgtcccgcaccgcgagaacatgagctatttcggcctc
gaacggctggcgaccgcatcgccggacgcgaccgcgcagcccgacgaagcgcacatgatc
taccagttcacgttgccgcccctgctggtgcataccctgaccagcggcgacgccacggcg
ctggaggcctgggcgcgcagcctgccctcgctgccgccgggatgcacctacttcaatttc
accgccagccatgacggcatcggcgtgcgagccctggagggcctgctgccgccccacgag
atcgaagcgatgctcgagctcatgcatcgcttcgggggctacgtgagcatgaaggccgac
gccgacggcaaggactccccctacgaagtcaacatcacctatttcgacgccctgcgcggc
acacgaagaggcgccgacccctggcaggtggagcgcttcctgtgcagccagcatctgatg
ctggccctgcaaggcatccccggcatctacttccactgcctgaccgccaccctcaacgac
catgaaggggtcgagcgcagcggccagttgcgcaccatcaaccggcgccgctggcagaag
gaagaactcgatgagttgctcgacagccgcaatacgcccacgcgcgaggtctttttggcc
ttgcgccgacgtctcaagctgcgtgcccaggagccctgcttccaccctcaggcggcgcag
cgcatcgtgaccacgcctccgacactgttcgccgtgcaacgtggcccgctcgacgatggc
cgccgtctgctcgcgatctacaacgtcaccgacaagcgccagcccctggaggtggccgaa
ctggacgaaggcagctggtacgacctgctggccgacgcgccctgggatgcctcggcacca
cgcgagttgcgcccctaccgcagcctctggctggtacagcgccccggcgcggattga

DBGET integrated database retrieval system