KEGG   Chromohalobacter salexigens: Csal_2620Help
Entry
Csal_2620         CDS       T00347                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
csa  Chromohalobacter salexigens
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Csal_2620
Enzymes [BR:csa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Csal_2620
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Csal_2620
Lipid biosynthesis proteins [BR:csa01004]
 Fatty acid synthase
  Component type
   Csal_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2933223..2933807
Genome map
AA seq 194 aa AA seqDB search
MGPVANVHADTLLIVGDSLSAAHGIEREAGWVALLRERVGDAHEVVNASISGDTTSGGAA
RLPDLLERHSPDIVLLELGGNDGLRGLSPQQMKLNLRTMIEKSQAADARVLLLGIEIPPN
YGAAYTDAFRGVFRQLSEEYAVPLVPFILDGVALQDDMMQEDGIHPNAAAQPTILDNVWE
KLGPMLSRDTDRNE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgtcgcgaatgtccatgccgatacgttgctgatcgtcggcgacagcctcagc
gcggctcacggcatcgaacgcgaggccggctgggtcgcgctgttgcgcgagcgcgtgggc
gatgcgcatgaagtggtcaatgccagcatcagcggcgacaccacctcgggcggcgcggca
cgcctgcccgatctgctcgagcgccattctcccgacatcgtcctcctcgagctgggcggc
aacgacggcctgcgcggactatcgccgcagcaaatgaagctcaatttgcgcacgatgatc
gaaaaaagccaagccgccgacgcccgtgtgcttctgctcggcatcgagattccccccaac
tatggcgccgcctataccgatgccttccgcggcgtctttcgtcaactcagcgaagaatac
gcggtgccgctggtgcccttcatcctcgacggcgtcgccttgcaggacgacatgatgcaa
gaggacggcattcaccccaacgccgctgcccagcccaccatcctcgacaatgtctgggag
aagctgggtcccatgctgtcgcgggacaccgaccggaacgaatga

DBGET integrated database retrieval system