KEGG   Chromohalobacter salexigens: Csal_2634Help
Entry
Csal_2634         CDS       T00347                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
csa  Chromohalobacter salexigens
Brite
Enzymes [BR:csa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Csal_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2946908..2947597)
Genome map
AA seq 229 aa AA seqDB search
MHCRIPDTQDTHRLGGIGMTSQRTRNRLIRRLQANGIRDTRVLETMAREPRHLFVDEALA
HRAYEDTALPLGHGQTLSQPWIVARMTELVLTARPRRVLEVGTGSGYQTLILARLVEAVW
SIERIGALHQRAAARLAMLGADNVRLRHEDGGHGWPQAAPYDVILLTACASVLPPELLAQ
LADGGELIAPLEDDAGRQWLTRVRRCGITFERTRLERVRFVPLLEGVIQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtcgaattcctgatacgcaagatacccatcgtctcggcggtatcggcatgacc
tcgcagcgtacccgcaaccgcctgatccggcggctgcaggcgaacggcattcgcgacacg
cgggtgctggagaccatggcgcgcgagccgcgccacctcttcgtcgacgaggccctggcg
catcgtgcctacgaggacaccgcgcttcccctggggcacggacagacgctgtcgcaaccc
tggatcgtggcccgcatgacggaactggtgctgaccgcgcgtccccgtcgtgtgctggaa
gtgggcacggggtccgggtatcagaccttgatcctggcgcgactggtcgaggccgtgtgg
agcatcgagcgcatcggggcgctgcatcagcgtgccgccgcacgccttgccatgctgggc
gccgacaacgtgcgtctgcgtcacgaggacggcggccacggctggccgcaggcggcgccc
tacgacgtcatcctgctcaccgcctgcgccagcgtcttgccgcccgagctattggcgcag
ctggcggacgggggcgagctgatcgcgccgctggaggatgacgcgggacgccaatggctg
acacgcgtgcggcgttgtggcatcacattcgaacgaacacgactggaacgcgtcagattc
gtaccgctactggaaggggtcatacaatga

DBGET integrated database retrieval system