KEGG   Chromohalobacter salexigens: Csal_2647Help
Entry
Csal_2647         CDS       T00347                                 

Definition
PfkB protein
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
csa  Chromohalobacter salexigens
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Csal_2647
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Csal_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2959833..2960801)
Genome map
AA seq 322 aa AA seqDB search
MARVLTLTLNPALDLAIRLPALTLGAVNRTDATHLEAAGKGVNVARVLVALGHEVAVTGF
LGGDNDGAFVRAFADWGLEDAFLRLAGDTRINAKVAEARGRVTDINGPGLDVSRDDLAAL
YRALEARLTDAATRPDAVVIAGSLPPGVAPDDLGALIRWLRAHDLPVWVDTSGAALSAAI
AATPSAVKPNETELAEWAGEPLADMTARVAAATRLHAAGIEHALVSLGGEGMLWVGPQGS
WQATPPPVEVASTVCAGDTLLAAMLHGQLAGLPAEDALRLASGLSAEAVRHVGVGDVKAS
DLEQLQQRTRVRRLDDGARETL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgtgctgacattgaccctcaatcccgccctggacctggcgattcgcctgccc
gcgctgaccctgggggcggtcaatcgcaccgatgccacccacctcgaggcggcgggcaag
ggcgtcaacgtcgcccgggtgctggtcgcgctgggacacgaggtggcggtgaccggcttt
ctgggcggcgacaacgatggcgctttcgtacgcgccttcgccgactggggactggaggat
gccttcctgcgtctggccggcgacacgcgcatcaatgccaaggtggccgaagcccgggga
cgcgtcaccgatatcaacggccccgggctcgacgtctcgcgcgatgatctggcggccttg
taccgcgcgctcgaggcgcggctgacggatgccgcgacacgtcccgacgcggtggtgatt
gccggcagtcttcccccgggggtggcgcccgacgatctgggcgccttgattcgctggctg
cgtgcgcatgacctgccggtctgggtggacaccagtggcgcggcgttgagcgccgcgatc
gcggccacgccgagtgccgtcaaacccaacgagacggaactggccgagtgggccggcgag
cccctggcggacatgaccgcgcgcgtcgccgccgcgacgcgcttgcacgcggcgggcatc
gaacatgcgctggtctcgctgggaggcgagggcatgctgtgggtgggaccgcaaggcagc
tggcaggccacgccgccgccggtcgaggtcgccagtaccgtgtgtgccggtgacaccctg
ctggcagcgatgctgcatggtcaattggcgggcttgcctgccgaggacgcgttgcgcctg
gcgagcggattgtccgccgaggcggtgcgccatgtcggggtcggcgatgtgaaggcctcg
gacctagagcaactccaacaacgcacgcgcgttcgtcggctcgacgacggcgcgagggag
accctatga

DBGET integrated database retrieval system