KEGG   Chromohalobacter salexigens: Csal_2721Help
Entry
Csal_2721         CDS       T00347                                 

Definition
twin-arginine translocation pathway signal
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
csa  Chromohalobacter salexigens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Csal_2721
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Csal_2721
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Csal_2721
Enzymes [BR:csa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Csal_2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3049422..3050972)
Genome map
AA seq 516 aa AA seqDB search
MRYSRRDVLGWGVKAGVALGAASLAPSIVLAESRRPRVTSGVMSGDMLHDRAMLWSRSDR
PALMLVELADNPAFRGARQLRGPEVLPSGGLVGKLDVAGLGDIDTLHYRVRFAALDDPRA
LSEPVEGRLRLPPSRARDVRFVWSGDTVGQGWGIDESRGGMTIYDTMRRQRPDFFIHSGD
TVYADGPLEESVTLANGETWRNVVTPAKRKVAETLDEYRGQHTYNLLDANLRRFNAEVPM
LAQWDDHETTNNWYPGERLEDERYTERNVSLLAARGRQAFLEHTPIRQRSTAPGRIHRRF
AYGPSLEVFMLDMRTYRGANSRNRQTESSAQTAFLGEDQFDWLHRSLKASTATWKVIASD
MPIGLVVSDVEAYEAIANGDAGAPLGREREIARLLRSIRDDKIHNVVWLTADVHYTAAHH
YSPERARFQEFTPFWEFVSGPLHAGTFGPGALDATFGPEVVFQKAPPDGESNLPPSRGYQ
FFGQVDLDGDSETLTVSLMDAAGNTLHRQQLTPETA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgttattcccgtcgcgatgtattggggtggggcgtcaaggccggggtcgcgctcggc
gcggcgtcgctggcaccgtcgatcgtgctggccgagtcacggcgtccccgcgtgacctcg
ggggtgatgagcggcgacatgctgcacgaccgggcgatgctctggtcgcgcagcgaccgc
cccgccctgatgctcgtcgaactggccgacaatcccgccttccgtggcgcgcggcagttg
cgcggccccgaggtgctgcccagcggtggcctggtcggcaagctggacgtcgcaggactc
ggtgacatcgataccctgcattatcgcgtgcgtttcgccgcgctggatgacccgcgtgcc
ctgagcgagccggtcgaggggcgtctgcgcctgccgccctcccgggcgcgggacgtgcgc
ttcgtgtggtccggcgatacggtcgggcaaggctggggcatcgatgaatcgcgtggcggc
atgacgatctacgacaccatgcgccgtcagcgtccggatttcttcatccactccggcgac
accgtctacgccgacggccctctggaagaaagcgtgaccctcgccaatggcgagacctgg
cgcaacgtggtcaccccggccaagcgcaaggtggcggaaacgctggacgagtatcgcggc
cagcacacctacaacctgctcgatgccaacctgcggcgcttcaatgccgaggtgcccatg
ctcgcgcaatgggacgatcacgagacgacaaacaactggtatcccggcgagcggctcgag
gacgaacgctacacggaaaggaacgtgtcgctgttggcggcgcgcgggcgtcaggccttt
ctcgaacataccccgattcgccagcgctcgaccgcgccgggacgcatccatcggcgcttt
gcgtatgggccctcgctcgaggtcttcatgctcgacatgcgaacctatcgtggcgccaac
agccgcaatcgccagaccgagagctccgcgcagacggcttttctgggggaggatcagttc
gactggctgcaccgctcgctgaaggcgtccacggcgacatggaaggtcatcgcctcggac
atgcccatcggtctggtggtcagcgatgtcgaggcgtacgaggccatcgccaacggggat
gcgggcgctcccctggggcgtgagcgtgagatcgccaggctgctgcggtcgatccgggac
gacaagatccacaacgtggtgtggctgacggcggatgttcactacacggccgcgcatcac
tattcgccggagcgtgcccgtttccaggagttcacgcccttctgggaattcgtcagcggt
ccattgcatgccggcaccttcggccccggtgcgctggacgcgaccttcgggccggaagtg
gttttccagaaagccccgcctgacggcgagtcgaacctgccgccatcccggggctatcaa
ttcttcggccaggtcgatctcgacggcgacagcgagacgttgaccgtgagcctgatggat
gccgccggcaacacgctgcatcgtcagcagctgacgccggagacggcgtaa

DBGET integrated database retrieval system