KEGG   Chromohalobacter salexigens: Csal_2838Help
Entry
Csal_2838         CDS       T00347                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
csa  Chromohalobacter salexigens
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Csal_2838
Enzymes [BR:csa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Csal_2838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3168376..3169338
Genome map
AA seq 320 aa AA seqDB search
MSEHDTPRFNQPLGGNDMPRFGGPASMMRLPTQESAQGLDAAFVGIPMDIGTSNRPGTRL
GPRQIRDESRMLRPYNMATRAAPFDSLQVADIGDVPINTFDLKKSIGIIENFYHELLSHD
AVPLTLGGDHTLTWPILRAMARKHGPVGLIHIDAHADVNEHMFGEEVAHGCPFRRAQEEG
LLDSQRVVQIGLRGTGYAADDFDWCREQGFRVVTAEQCWHKSLEPLMAEVREQMGDGPVY
VSFDIDGLDPSVAPGTGTVEAAGLTMPQGLEIVRGVQGLNMVGGDLVEVAPPYDPSGNTA
LMGATLLYEMLCVLPGVKRR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcacgacaccccgcgcttcaaccaaccgctaggtggcaacgacatgccgcgc
ttcggcggtcccgccagcatgatgcgcctgccgacgcaggagagcgcccagggactcgac
gccgccttcgtgggcatccccatggacatcggtacctcgaaccggcctggcacccgcctc
ggaccgcgccagattcgcgatgaatcgcgcatgctgcgcccctacaacatggccacccgc
gccgccccgttcgacagcctgcaggtcgccgatatcggcgatgtgccgatcaataccttc
gacctcaagaaaagcatcggcatcatcgagaacttctaccatgagctgctctcgcatgac
gccgtgcccctgacccttggcggcgaccacaccctgacctggccgatcctgcgcgccatg
gcccgcaagcacggtcccgtcggcctgatccacatcgacgcccatgccgacgtcaacgag
cacatgttcggcgaggaagtcgcccacggctgcccgttccgtcgcgcccaggaagaaggc
ctgctggacagccagcgcgtggtgcagatcggcctgcggggcaccggctacgctgccgac
gacttcgactggtgccgcgagcagggcttccgcgtcgtgaccgccgagcaatgctggcac
aagtcgctggaacccctgatggccgaagtccgcgagcagatgggcgatggcccggtatac
gtgtccttcgacatcgacgggctcgacccttcggtggcgcccggcaccggcaccgtcgag
gccgccggcctgaccatgccgcaggggctcgagatcgtgcgcggcgtccagggcctcaac
atggtcggcggcgacctggtcgaggtcgcgccgccctacgaccccagcggcaataccgcg
ctgatgggcgccaccctgctctacgaaatgctctgcgtgctgcccggcgtcaagcgccgc
tga

DBGET integrated database retrieval system