KEGG   Chromohalobacter salexigens: Csal_2870Help
Entry
Csal_2870         CDS       T00347                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
csa  Chromohalobacter salexigens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:csa00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3201681..3202328
Genome map
AA seq 215 aa AA seqDB search
MLQDALDIVDRHCALIVIDVQPDFMPGGPLACADGDAILPGLTQLLGERRFAHVVATQDW
HPPRHVSFASQHAGHAPFDTLDLYGEPQTLWPDHCVQNTAGAQLHPEIDWAPVDLIVRKG
SDPRVDSYSAFRHNLGPEGTRPTTGLAGWLREREVETVHVCGLARDVCVLWSAEDAVAAG
FRTRFLWPLTRPVTHDTDAATRQRLTRLGVEIIGA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcaggatgccctcgatatcgtcgaccgccactgcgcattgatcgtcatcgacgta
cagcccgacttcatgcccggcggccccctggcctgcgccgacggcgacgccattctcccg
gggctgacccagttgctcggcgagcggcgcttcgcgcatgtggtggcgacccaggactgg
catccgccaaggcacgtctccttcgccagccagcatgccggacacgcccccttcgacacc
ctcgatctctacggcgagccgcagaccctgtggcccgaccattgcgtccagaacaccgcc
ggcgcccagttgcaccccgagatcgactgggccccggtggacctcatcgtgcgcaagggc
agcgacccgcgcgtcgattcctacagcgcctttcgccacaacctgggcccggagggcacg
cgccccaccaccggcctggccggctggttgcgcgaacgtgaggtggagacggtccatgtc
tgcggcctggcacgcgatgtctgcgtgctctggagcgccgaggacgccgtcgccgccggc
tttcgcacgcgcttcctctggcccctgacgcgtcccgtcactcacgacacggatgccgcc
acgcggcagcgtctgacccggctcggggtcgagatcatcggcgcctga

DBGET integrated database retrieval system