KEGG   Chromohalobacter salexigens: Csal_2912Help
Entry
Csal_2912         CDS       T00347                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Csal_2912
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_2912
  Lipid metabolism
   00071 Fatty acid degradation
    Csal_2912
  Amino acid metabolism
   00350 Tyrosine metabolism
    Csal_2912
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Csal_2912
   00626 Naphthalene degradation
    Csal_2912
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Csal_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3243099..3244127)
Genome map
AA seq 342 aa AA seqDB search
MDKTMKAAVVRQFGEPLVIEEVATPRPQQGEILVEVAASGVCHTDLHAAHGDWPVKPSPP
FIPGHEGVGHIVAVGEGVKHVKEGDRVGVPWLYSTCGHCEHCLGGWETLCESQQNTGYSV
NGGFADYTLADANYVGRLPDNVDFLEIAPVLCAGVTVYKGLKMTDARPGQWVVISGIGGL
GHMAVQYARAMGFNVAAVDIDDGKLALAERLGATVVVNASKADPAETLKREIGGAHGALV
TAVSPKAFDQAQRMLRRGGTLVLNGLPPGDFPLPIFDTVLNGITVRGSIVGTRQDLQEAL
DFAGQGKVEATIATEKLENINDVFQRMLDGKIEGRIVLDMTG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacgatgaaagctgccgtggtccgccaattcggcgaaccgctggtgatcgag
gaagtcgcgaccccgcgaccgcagcagggggaaattctggtcgaggtggccgcctcgggc
gtgtgccacaccgatctgcatgccgcccacggtgactggccggtcaagcccagcccaccc
ttcatccccggccacgagggcgtcggccatatcgtggcggtgggcgagggcgtcaagcac
gtcaaggagggcgaccgtgtcggcgtgccgtggctctattcgacctgcggccattgcgag
cactgcctggggggctgggagaccctgtgcgagtcgcagcagaataccggctactcggtg
aacggcggtttcgccgactacaccctggccgatgccaactacgtggggcggctgcccgac
aacgtcgacttcctggagatcgcgccggtgctgtgtgccggcgtgacggtctacaaaggg
ctcaagatgaccgacgcccgccctgggcagtgggtggtgatctcggggatcggcggtctc
ggccacatggcggtgcaatacgccagggccatgggcttcaacgtggcggcggtggatatc
gatgacggcaagctggcgctggccgaacgcctgggagccaccgtcgtcgtcaatgcctcg
aaggccgatccggccgagaccctcaagcgcgagatcggcggggctcatggcgcgctggtc
actgccgtgtcgcccaaggccttcgatcaggcccagcgcatgctgcgtcgcggcggcacc
ctggtgctcaatggcctgccgccgggcgacttcccgctgccgatcttcgatacggtgctc
aacggcatcaccgtgcgcggctccatcgtcggcactcgacaagaccttcaggaagcgctc
gatttcgccggtcaaggcaaggtcgaggccaccatcgccaccgagaagctggaaaacatc
aatgacgtcttccagcgcatgctcgacggcaagatcgaagggcggatcgtgctggacatg
acgggctga

DBGET integrated database retrieval system