KEGG   Chromohalobacter salexigens: Csal_2983Help
Entry
Csal_2983         CDS       T00347                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00010  Glycolysis / Gluconeogenesis
csa00030  Pentose phosphate pathway
csa00051  Fructose and mannose metabolism
csa00052  Galactose metabolism
csa00230  Purine metabolism
csa00500  Starch and sucrose metabolism
csa00520  Amino sugar and nucleotide sugar metabolism
csa00521  Streptomycin biosynthesis
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_2983
   00030 Pentose phosphate pathway
    Csal_2983
   00051 Fructose and mannose metabolism
    Csal_2983
   00052 Galactose metabolism
    Csal_2983
   00500 Starch and sucrose metabolism
    Csal_2983
   00520 Amino sugar and nucleotide sugar metabolism
    Csal_2983
  Nucleotide metabolism
   00230 Purine metabolism
    Csal_2983
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Csal_2983
Enzymes [BR:csa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Csal_2983
    5.4.2.8  phosphomannomutase
     Csal_2983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ABE60328
JGI: Csal2983
UniProt: Q1QT80
Position
3321780..3323183
Genome map
AA seq 467 aa AA seqDB search
MSQQASISASIFRAYDIRGIVDDTLTEEGVELIGRAIGAEAASRGESTVVVARDGRHSGQ
RLQAALMRGLRRAGRDVVDIGMVPTPVLYFATHTLDGTRSGVMVTGSHNPPDYNGFKIVL
GGETLSGEAITALYQRIQDDALGDGDGGLREMDVRDAYLERILGDVVLNGRIKAVVDCGN
GVAGELGPKLIERLGAETVPLFAEIDGDFPNHHPDPGKLENLEDLIRTVKETGADIGLAF
DGDGDRLGVVTPAGEVIYPDRLMMAFAEDMLERNPGARVIFDVKCTGNLAQVIENAGGTP
EMWRTGHSLIKARMKETGAALAGEMSGHIFFKERWYGFDDGLYGAARLLEILARQRAEHD
LDADAFFARFPQDLGTPEINVKVTDDNKFDIVEKLARDGDFGDDGVKTTLDGIRVDFADG
WGLCRASNTTPMLVLRFEGKNQDALSRIQAQFRAALKQVAPEADLPF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaagcttccatcagcgcttccatcttccgcgcctatgacatccgcggcatc
gtcgacgacaccctgaccgaggaaggcgtcgagctgatcggtcgcgccatcggtgccgaa
gccgccagccgcggcgagtccacggtggtcgtcgcacgcgatggccggcattcgggccag
cgcctgcaggccgccttgatgcgcggcctgcgccgcgcggggcgcgacgtcgtcgatatc
ggcatggtgcccacgccggttctctacttcgccacccacacgctggacggcacgcgctcc
ggcgtcatggtcaccggcagccataacccgcccgactacaatggcttcaagatcgtgctg
ggcggcgaaaccctgtccggcgaggcgatcaccgcactctaccagcgcatccaggacgac
gcgctcggcgatggcgacggcggcctgcgggagatggatgtacgcgatgcctatctggaa
cgcatcctcggtgatgtcgtcctgaacggacgcatcaaggccgtggtcgactgtggcaac
ggcgtggccggcgagctggggcccaagctgatcgagcgcctgggcgccgagaccgtaccg
ctgttcgccgagatcgacggcgacttccccaaccaccatcccgaccccggcaagctcgaa
aacctcgaggacctgatccgcaccgtcaaggaaaccggcgcggacatcggcctggccttc
gacggcgacggcgaccgcctcggcgtggtgacgcccgccggcgaggtgatctatcccgac
cgtctgatgatggccttcgccgaggacatgctcgagcgcaatcccggcgcccgcgtgatc
ttcgacgtcaagtgcaccggcaacctggcccaggtgatcgaaaacgccggcggcacgccc
gagatgtggcgcaccggccactcgctgatcaaggcgcgcatgaaggaaaccggcgcggca
ttggccggcgagatgagcggccacatcttcttcaaggaacgctggtacggtttcgacgat
ggcctgtacggcgccgcgcggctgctggagattcttgccaggcagcgcgccgagcacgac
ctggacgccgatgccttcttcgctcgctttccgcaggacctgggcacgccggaaatcaac
gtcaaggtgaccgacgacaacaagttcgacatcgtcgagaaactggcccgcgacggcgat
ttcggcgacgacggcgtcaagaccacgctcgacggcatccgtgtcgacttcgcggatggc
tgggggctgtgccgcgcctccaacaccacgccgatgctggtgctgcgtttcgaaggcaag
aaccaggacgccttgtcgcgcatccaggcccagtttcgcgccgccctcaagcaggtcgcc
cccgaggccgatctcccgttctga

DBGET integrated database retrieval system