KEGG   Chromohalobacter salexigens: Csal_2983Help
Entry
Csal_2983         CDS       T00347                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_2983
   00030 Pentose phosphate pathway
    Csal_2983
   00051 Fructose and mannose metabolism
    Csal_2983
   00052 Galactose metabolism
    Csal_2983
   00500 Starch and sucrose metabolism
    Csal_2983
   00520 Amino sugar and nucleotide sugar metabolism
    Csal_2983
  Nucleotide metabolism
   00230 Purine metabolism
    Csal_2983
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Csal_2983
Enzymes [BR:csa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Csal_2983
    5.4.2.8  phosphomannomutase
     Csal_2983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3321780..3323183
Genome map
AA seq 467 aa AA seqDB search
MSQQASISASIFRAYDIRGIVDDTLTEEGVELIGRAIGAEAASRGESTVVVARDGRHSGQ
RLQAALMRGLRRAGRDVVDIGMVPTPVLYFATHTLDGTRSGVMVTGSHNPPDYNGFKIVL
GGETLSGEAITALYQRIQDDALGDGDGGLREMDVRDAYLERILGDVVLNGRIKAVVDCGN
GVAGELGPKLIERLGAETVPLFAEIDGDFPNHHPDPGKLENLEDLIRTVKETGADIGLAF
DGDGDRLGVVTPAGEVIYPDRLMMAFAEDMLERNPGARVIFDVKCTGNLAQVIENAGGTP
EMWRTGHSLIKARMKETGAALAGEMSGHIFFKERWYGFDDGLYGAARLLEILARQRAEHD
LDADAFFARFPQDLGTPEINVKVTDDNKFDIVEKLARDGDFGDDGVKTTLDGIRVDFADG
WGLCRASNTTPMLVLRFEGKNQDALSRIQAQFRAALKQVAPEADLPF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaagcttccatcagcgcttccatcttccgcgcctatgacatccgcggcatc
gtcgacgacaccctgaccgaggaaggcgtcgagctgatcggtcgcgccatcggtgccgaa
gccgccagccgcggcgagtccacggtggtcgtcgcacgcgatggccggcattcgggccag
cgcctgcaggccgccttgatgcgcggcctgcgccgcgcggggcgcgacgtcgtcgatatc
ggcatggtgcccacgccggttctctacttcgccacccacacgctggacggcacgcgctcc
ggcgtcatggtcaccggcagccataacccgcccgactacaatggcttcaagatcgtgctg
ggcggcgaaaccctgtccggcgaggcgatcaccgcactctaccagcgcatccaggacgac
gcgctcggcgatggcgacggcggcctgcgggagatggatgtacgcgatgcctatctggaa
cgcatcctcggtgatgtcgtcctgaacggacgcatcaaggccgtggtcgactgtggcaac
ggcgtggccggcgagctggggcccaagctgatcgagcgcctgggcgccgagaccgtaccg
ctgttcgccgagatcgacggcgacttccccaaccaccatcccgaccccggcaagctcgaa
aacctcgaggacctgatccgcaccgtcaaggaaaccggcgcggacatcggcctggccttc
gacggcgacggcgaccgcctcggcgtggtgacgcccgccggcgaggtgatctatcccgac
cgtctgatgatggccttcgccgaggacatgctcgagcgcaatcccggcgcccgcgtgatc
ttcgacgtcaagtgcaccggcaacctggcccaggtgatcgaaaacgccggcggcacgccc
gagatgtggcgcaccggccactcgctgatcaaggcgcgcatgaaggaaaccggcgcggca
ttggccggcgagatgagcggccacatcttcttcaaggaacgctggtacggtttcgacgat
ggcctgtacggcgccgcgcggctgctggagattcttgccaggcagcgcgccgagcacgac
ctggacgccgatgccttcttcgctcgctttccgcaggacctgggcacgccggaaatcaac
gtcaaggtgaccgacgacaacaagttcgacatcgtcgagaaactggcccgcgacggcgat
ttcggcgacgacggcgtcaagaccacgctcgacggcatccgtgtcgacttcgcggatggc
tgggggctgtgccgcgcctccaacaccacgccgatgctggtgctgcgtttcgaaggcaag
aaccaggacgccttgtcgcgcatccaggcccagtttcgcgccgccctcaagcaggtcgcc
cccgaggccgatctcccgttctga

DBGET integrated database retrieval system