KEGG   Chromohalobacter salexigens: Csal_3009Help
Entry
Csal_3009         CDS       T00347                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00260  Glycine, serine and threonine metabolism
csa00750  Vitamin B6 metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01230  Biosynthesis of amino acids
Module
csa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Csal_3009
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Csal_3009
Enzymes [BR:csa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Csal_3009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABE60353
JGI: Csal3009
UniProt: Q1QT55
Position
complement(3350605..3351993)
Genome map
AA seq 462 aa AA seqDB search
MRYISTRGEAPALSFEDVVLTGMAADGGLYVPETIPTFSQAELEAMAGLSYAEIAFRVMK
PFVGGEIDDATFRHLVEDAYATFSHEAVVPLNQLSSNHFLLELFHGPTLAFKDVALQLLG
RILDHFLAKRGERAVIMGATSGDTGSAAIEGCRHCDNLDIFILHPHNRVSEVQRRQMTTV
LADNVFNIAIEGNFDDAQAMVKASFADQRFLKGTRLVAVNSINWARIMAQVVYYVASAVA
LGAPRREVSFCVPSANFGNVFAGYVASRMGLPVKQFIVATNANDILHRTLAANDFSKQAL
KATLAPSMDIVVSSNFERLLFEAYDRDGAAVRDLLERFQHEPTVLAEAPLARLREQFSSF
SVDDATILEVIREAHARTKELLDPHTATGYRAAERVRADEVTPMITLATAHPAKFADAVI
KAGIDEVPLPSHMDGLLEREERYQVLPADLEAVQAFVAEQRR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacgcgcggcgaggcgccggcgctgagtttcgaggatgtcgtgctg
accggcatggccgccgacggtggtctgtacgtgccggaaacgatccccaccttctcgcag
gcggagctcgaggcgatggccgggctgtcatatgccgagatcgcgtttcgggtgatgaag
ccgttcgtgggcggggagatcgatgacgcgaccttccggcacctggtggaagacgcctac
gcgaccttcagccacgaagcggtggtgcccctcaaccagctgtcgagcaatcatttcctg
ctcgagctgttccatggcccgaccctggcgttcaaggacgtcgccctgcagctgctggga
cgcatcctcgatcacttcctggccaagcgtggcgagcgcgcggtgatcatgggcgccacg
tccggggataccggctcggcggcgatcgaaggctgccggcattgcgacaatctggacatc
ttcatcctgcatccgcacaaccgggtgtccgaggtccagcgccggcagatgaccaccgtg
cttgccgacaacgtcttcaacatcgccatcgagggcaacttcgatgacgcccaggcgatg
gtcaaggcgagcttcgccgaccagcgtttcttgaagggcacgcgcctggtggcggtgaac
tccatcaactgggcgcgcatcatggcgcaggtggtctactacgtggcttctgccgtggcg
ttgggcgcgccgcgccgcgaggtgagcttctgcgtgccgtccgccaacttcggcaatgtc
ttcgccggctacgtggcatcgcgcatggggttgccggtcaagcaattcatcgtcgccacc
aacgccaacgacatcctgcatcgcaccctggccgccaacgacttctccaagcaggcgctc
aaggcgacgctggcgccgtcgatggatatcgtcgtgtcgtcgaatttcgagcgcttgctg
ttcgaggcctatgatcgcgacggcgcggcggtgcgtgacctgctcgagcgattccagcac
gaacccacggtgcttgccgaggcgcccctggcgcgactgcgcgagcagttctccagcttc
agcgtcgacgacgcgaccatcctcgaggtgattcgcgaggcgcatgcccgcaccaaggaa
ctgctcgatccgcacactgccaccgggtatcgcgcggccgagcgcgtgcgtgccgacgag
gtcaccccgatgatcaccctggcgaccgcgcatccggccaagttcgccgatgccgtgatc
aaggcgggcatcgacgaagtgccgttgccgtctcacatggatggcttgctggagcgcgag
gagcgctatcaggtactgcctgccgacctggaagccgtgcaggccttcgtcgccgaacag
cgccgctga

DBGET integrated database retrieval system