KEGG   Chromohalobacter salexigens: Csal_3011Help
Entry
Csal_3011         CDS       T00347                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
csa  Chromohalobacter salexigens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3353477..3354214)
Genome map
AA seq 245 aa AA seqDB search
MPRVPLSVLGGALALLIAPLTLAAPPEGLADKLNHNGQPLPVISIDDSPLSGLYEVHLKG
GQTLYTDANGEYMVVGDLYRNRDGQMINLTERAANERRVERLDAIPDEQRVIYKPAGEVK
ARVTVFTDTSCPYCQKLHEAVPRLNQMGIEVDYLAFPRAGVDSEAARVMRHAWCADNASE
ALSAAMRGDDAPTSAAQCDAPVAEQHALGIELGIQGTPAIVLPDGRMLPGYVPPERLAAM
LGIDE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagtcccgttgtccgtcctgggaggtgccctggccctcctgatcgcaccgctg
acgctcgccgctcctcccgaggggctggccgacaagctgaaccacaatggccagccgctg
ccggtgatctcgatcgatgattcaccactgtcggggctctatgaggtgcatctcaagggt
ggtcagactctctataccgatgcgaatggcgagtacatggtggtcggcgacctctatcga
aaccgcgatgggcagatgatcaacctcaccgagcgtgccgccaacgagcgccgggtcgag
cggctcgatgcgattcccgacgagcaacgcgtgatttacaagcccgccggcgaggtcaag
gcacgcgtgaccgtgttcaccgatacctcgtgcccttattgccagaagctgcatgaagcc
gtaccccgtctcaatcagatgggaatcgaggtagactatctggccttcccgcgtgccggt
gtcgactccgaggcggcgcgggtgatgcgccacgcctggtgtgctgacaatgccagcgag
gcattgagtgccgccatgcgcggcgacgacgcaccgacctccgcggcgcagtgcgatgcg
ccggtggccgagcagcatgccctgggcatcgagctgggcattcagggcacgcccgccatc
gtgctgccggatggccgcatgctgccgggatacgtgccgccggagcggctggccgcgatg
ctgggcatcgacgagtga

DBGET integrated database retrieval system