KEGG   Chromohalobacter salexigens: Csal_3078Help
Entry
Csal_3078         CDS       T00347                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
csa  Chromohalobacter salexigens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csal_3078
   01230 Biosynthesis of amino acids
    Csal_3078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_3078
   00051 Fructose and mannose metabolism
    Csal_3078
   00562 Inositol phosphate metabolism
    Csal_3078
Enzymes [BR:csa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Csal_3078
Exosome [BR:csa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Csal_3078
  Exosomal proteins of bladder cancer cells
   Csal_3078
  Exosomal proteins of melanoma cells
   Csal_3078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3428729..3429478)
Genome map
AA seq 249 aa AA seqDB search
MRTPLIAGNWKMNGSSALVDAFGQAFADADLPESVEVVVHPPFPYLDAARRALAGGPVKL
GAQTLNPLHAGARTGEVSGRMLKEFDVEYVLVGHSERRELYRESDDDVYDRLLAALNADL
RPILCVGETLEARDAGRTRDVVLRQVGHALAPLEPAQRARVTIAYEPVWAIGTGRTATPE
QAQEVMAAIREYQAGFDPALAQSMRLIYGGSMNAANAAELLAQPDIDGGLVGGASLKVDD
FLAICHSAR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgccgctgatcgcgggcaattggaagatgaacggttcgagcgccctggtcgac
gcgttcggccaggcctttgccgatgccgaccttcccgagtcggtggaagtcgtggtgcat
ccaccgttcccctatctcgatgcggcgcgccgggctctggccggcgggcccgtcaagctc
ggggcgcagacgctcaaccccctgcatgcgggagcgcgcacgggtgaggtcagtgggcgc
atgctcaaggaattcgacgtcgagtacgtcctggtcgggcactccgagcgccgcgagctc
tatcgcgaaagcgacgacgacgtttatgaccggctgttggcggccctgaatgccgacctg
cggccgatcctgtgtgtcggcgagacgctcgaggcacgcgatgccgggcgtacgcgcgat
gtcgtgctgcgccaggtcggacatgcgctggcgcccctggaacccgcgcaacgggcccgc
gtaacgatcgcctacgagcccgtctgggccatcggcaccgggcgtaccgcgacgcccgaa
caggcacaagaggtcatggccgcgatccgcgagtaccaggccggcttcgatcctgccctg
gcccagtcgatgcgactgatctacgggggcagcatgaacgcggccaacgcggccgaactt
ctggcccagccggatatcgacggcggcctggtgggcggtgcttcgctcaaggtcgacgat
tttctagccatctgtcattcagcaaggtag

DBGET integrated database retrieval system