KEGG   Chromohalobacter salexigens: Csal_3154Help
Entry
Csal_3154         CDS       T00347                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
csa  Chromohalobacter salexigens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csal_3154
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Csal_3154
   00630 Glyoxylate and dicarboxylate metabolism
    Csal_3154
Enzymes [BR:csa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Csal_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3518134..3520362)
Genome map
AA seq 742 aa AA seqDB search
MTDRTTRHRLQVASQLDRFINDEALPGTGVDPEAFWAGFDALVHELVPTNRDLLAERERL
QDELDAWHKANPGPVRDMAAYRAFLKDIGYLVEAPAKVQATTANVDDEIAVQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDVIPETDGAEKSQGYNPKRGEKVIAYARGVLDQAA
PLAEGTHAEASAYALRDGKLVVTLQGGGETGLADPAQLVGYRGEAQAPTAVLLANHGLHL
EVQFDATHPIGKTDPAHVKDVLVEAAVSTIMDCEDSVAAVDADDKTLVYRNWLGLMKGDL
EERFDKGGKTVTRALNPDRDYTVPGGGELRLPGRSLLFVRNVGHLMTTPAVLDGDGNEIP
EGMLDGVVTSLLAIHDLKKGDGAAPSATAPEAKRNSRTGSVYIVKPKMHGPREVAFANSL
FMRIEDMLGLPRDTLKMGIMDEERRTSINLDACIHEAASRVAFINTGFLDRTGDEMHTAM
EAGPMLRKGEMKGTKWIAAYEKNNVQTGLACGLRGRAQIGKGMWAMPELMAAMLEQKIGH
PQAGATTAWVPSPTAAVLHALHYHQVDVATIQRELEAKPGGDFLDDLLTVPVVESAASGA
NKSPSWSDDEIQQELDNNCQGILGYVVRWVEHGVGCSKVPDIHDVGLMEDRATLRISSQH
IANWLHHGIVSEARVRETLERMAKVVDDQNAHDPDYTPMTSHLAESCAFQAASDLIFKGR
EQPAGYTEPLLHHWRAVHKAKS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccgtacgacacgccatcgtttgcaggtggccagccagctcgaccgtttcatc
aacgacgaagcgttgccgggaacgggcgtcgaccccgaggccttctgggccgggttcgat
gccctggtccacgagctcgtgcccaccaatcgtgacctgctggccgagcgcgagcgactg
caggacgaactggacgcctggcacaaggcgaaccccgggccggtgcgggacatggccgcc
tatcgtgccttcctgaaggacatcggttatctggtcgaggcgccggccaaggtgcaggcc
accaccgccaatgtcgatgacgagatcgccgtgcaggcggggccccagctggtggtgccg
gtaagcaacgcgcgttatgccctcaatgccgccaatgcgcgctggggcagcctttacgac
gcgctctacggcaccgacgtgattcccgagacggacggcgccgaaaaaagccagggctac
aaccccaagcgtggcgaaaaggtcatcgcctacgcacgcggtgtgctcgaccaggcagcc
cccctggccgagggcacgcatgccgaggcgagcgcttatgctctgcgtgacggcaagctg
gtggtgaccctgcagggcggcggtgagacggggctggccgatcctgcgcaactggtcggt
taccgaggcgaggcacaggcgcccacggcggtgctgctcgccaatcatggcctgcatctg
gaagtccagttcgacgccactcaccccatcggcaagaccgatccggcccacgtcaaggac
gtgctggtcgaggcggcggtgagcaccatcatggactgcgaggactccgtggcggccgtg
gacgccgacgacaagacgctggtctatcgcaactggctggggctgatgaagggcgacctc
gaggagcgcttcgacaagggcggcaagacggtgacgcgcgccctcaacccggaccgcgac
tacacggtccccggcggtggcgagttgcgcctgcccggacgctctttgctgttcgtgcgc
aatgtcggccatctgatgaccacgccggccgtgctcgatggcgatggcaacgagattccc
gagggaatgctggatggcgtggtcaccagtctgctggcgattcacgacctcaagaaaggc
gacggcgctgccccgtccgccacggcaccggaggccaagcgtaatagccggacgggatcg
gtctatatcgtcaagcccaagatgcacggccccagggaagtggccttcgccaacagcctg
ttcatgcgcatcgaggacatgctgggcctgccgcgcgataccctcaagatgggcatcatg
gacgaggagcggcgtacctcgatcaacctcgatgcgtgcattcacgaggcggcgtcccgc
gtggcgttcatcaacaccggcttcctcgaccgtaccggcgacgagatgcacaccgccatg
gaagccggccccatgctgcgcaagggggagatgaagggcaccaagtggatcgcggcctac
gaaaagaacaatgtccagaccggcttggcgtgcggcctgcgcggccgggcgcagatcggc
aagggcatgtgggccatgccggagctgatggcagcgatgctcgagcagaagatcggccat
ccccaggccggtgcgaccacggcctgggtgccgtcacccaccgccgccgtgctgcatgcc
ctgcactaccatcaggtcgatgtcgcgacgattcagcgtgaactggaggccaagcccggt
ggcgactttctcgacgatctgctcaccgtgccggtggtcgaaagcgcggcttcgggcgct
aacaagagcccgagctggtccgacgacgagattcagcaggagctggataacaactgtcag
ggcatcctcggctatgtggtgcgctgggtcgagcatggcgtgggctgctccaaggtgccg
gacatccacgacgtggggctgatggaggatcgcgcgacgttgcgtatctccagtcagcac
atcgccaactggctgcatcatggcatcgtcagcgaggcacgggtacgcgagacgctggag
cgcatggccaaggtggtcgacgaccagaatgcccacgatcccgactatacgccgatgacc
tcgcacctggcggagtcctgcgcctttcaggcggcatccgacctgatcttcaaggggcgt
gagcagcccgccggctacaccgagccgctgctgcaccactggcgcgcggtgcacaaggcg
aaatcataa

DBGET integrated database retrieval system